Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8110
Gene name
LocationContig_51:10635..11327
Strand+
Gene length (bp)692
Transcript length (bp)552
Coding sequence length (bp)552
Protein length (aa) 184

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UST2|IMP2L_SCHPO Mitochondrial inner membrane protease subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC336.13c PE=3 SV=1 13 176 5.0E-31
sp|P46972|IMP2_YEAST Mitochondrial inner membrane protease subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP2 PE=1 SV=1 29 168 4.0E-26
sp|Q5PQ63|IMP2L_XENLA Mitochondrial inner membrane protease subunit 2 OS=Xenopus laevis GN=immp2l PE=2 SV=1 22 172 3.0E-25
sp|Q2KI92|IMP2L_BOVIN Mitochondrial inner membrane protease subunit 2 OS=Bos taurus GN=IMMP2L PE=2 SV=1 26 180 7.0E-25
sp|Q96T52|IMP2L_HUMAN Mitochondrial inner membrane protease subunit 2 OS=Homo sapiens GN=IMMP2L PE=2 SV=1 26 180 5.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UST2|IMP2L_SCHPO Mitochondrial inner membrane protease subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC336.13c PE=3 SV=1 13 176 5.0E-31
sp|P46972|IMP2_YEAST Mitochondrial inner membrane protease subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP2 PE=1 SV=1 29 168 4.0E-26
sp|Q5PQ63|IMP2L_XENLA Mitochondrial inner membrane protease subunit 2 OS=Xenopus laevis GN=immp2l PE=2 SV=1 22 172 3.0E-25
sp|Q2KI92|IMP2L_BOVIN Mitochondrial inner membrane protease subunit 2 OS=Bos taurus GN=IMMP2L PE=2 SV=1 26 180 7.0E-25
sp|Q96T52|IMP2L_HUMAN Mitochondrial inner membrane protease subunit 2 OS=Homo sapiens GN=IMMP2L PE=2 SV=1 26 180 5.0E-24
sp|Q6AZD4|IMP2L_DANRE Mitochondrial inner membrane protease subunit 2 OS=Danio rerio GN=immp2l PE=2 SV=1 22 182 8.0E-24
sp|Q8BPT6|IMP2L_MOUSE Mitochondrial inner membrane protease subunit 2 OS=Mus musculus GN=Immp2l PE=1 SV=1 26 172 9.0E-24
sp|Q28I39|IMP1L_XENTR Mitochondrial inner membrane protease subunit 1 OS=Xenopus tropicalis GN=immp1l PE=2 SV=1 23 179 1.0E-18
sp|Q96LU5|IMP1L_HUMAN Mitochondrial inner membrane protease subunit 1 OS=Homo sapiens GN=IMMP1L PE=2 SV=1 24 171 9.0E-18
sp|Q9CQU8|IMP1L_MOUSE Mitochondrial inner membrane protease subunit 1 OS=Mus musculus GN=Immp1l PE=1 SV=1 18 171 3.0E-17
sp|O74800|IMP1_SCHPO Mitochondrial inner membrane protease subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=3 SV=1 22 163 6.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8110
MAARSIWERLRPTRSSALRSAAGLVGFATWIPVIAWFNMHVAELTFIDGASMHPLLNEDRDSTLRRDMVLNYKWA
PQDGLERGMIVTLRSPLRPEAVVVKRVVALEGDVVQTKAPYPIPTVRIPQGHVWVEGDGPPRSSLDSNTYGPVSK
RLLTGRVTHFVYPLRKFGPVRWWEHERRQPLVL*
Coding >Hirsu2|8110
ATGGCAGCTCGATCAATCTGGGAGCGGCTGAGGCCCACGCGCTCCAGCGCTCTCCGGTCGGCGGCGGGGCTCGTC
GGCTTCGCGACGTGGATCCCCGTGATTGCCTGGTTCAACATGCACGTCGCCGAGCTGACCTTCATCGATGGGGCG
TCGATGCATCCTTTGCTGAACGAGGACCGAGACTCGACGCTGAGACGGGACATGGTCCTCAATTACAAATGGGCG
CCCCAGGACGGCCTGGAGCGAGGCATGATCGTTACGCTGAGGAGCCCGTTACGGCCGGAAGCCGTCGTCGTCAAG
AGAGTGGTGGCGCTGGAGGGAGACGTCGTCCAGACCAAGGCGCCGTATCCGATCCCAACCGTCCGCATCCCCCAG
GGCCACGTCTGGGTCGAGGGAGACGGCCCGCCGAGGTCGAGCCTGGACAGCAACACGTACGGCCCGGTCTCCAAG
AGACTTCTCACGGGCCGCGTGACTCATTTCGTCTACCCCTTGAGGAAATTCGGGCCGGTGCGGTGGTGGGAGCAC
GAGAGACGGCAGCCGTTGGTGCTGTAA
Transcript >Hirsu2|8110
ATGGCAGCTCGATCAATCTGGGAGCGGCTGAGGCCCACGCGCTCCAGCGCTCTCCGGTCGGCGGCGGGGCTCGTC
GGCTTCGCGACGTGGATCCCCGTGATTGCCTGGTTCAACATGCACGTCGCCGAGCTGACCTTCATCGATGGGGCG
TCGATGCATCCTTTGCTGAACGAGGACCGAGACTCGACGCTGAGACGGGACATGGTCCTCAATTACAAATGGGCG
CCCCAGGACGGCCTGGAGCGAGGCATGATCGTTACGCTGAGGAGCCCGTTACGGCCGGAAGCCGTCGTCGTCAAG
AGAGTGGTGGCGCTGGAGGGAGACGTCGTCCAGACCAAGGCGCCGTATCCGATCCCAACCGTCCGCATCCCCCAG
GGCCACGTCTGGGTCGAGGGAGACGGCCCGCCGAGGTCGAGCCTGGACAGCAACACGTACGGCCCGGTCTCCAAG
AGACTTCTCACGGGCCGCGTGACTCATTTCGTCTACCCCTTGAGGAAATTCGGGCCGGTGCGGTGGTGGGAGCAC
GAGAGACGGCAGCCGTTGGTGCTGTAA
Gene >Hirsu2|8110
ATGGCAGCTCGATCAATCTGGGAGCGGCTGAGGCCCACGCGCTCCAGCGCTCTCCGGTCGGCGGCGGGGCTCGTC
GGCTTCGCGACGTGGATCCCCGTGATTGCCTGGTTCAACATGCACGTCGCCGAGCTGACCTTCATCGATGGGGCG
TCGATGCATCCTTTGCTGAACGAGGACCGAGACTCGACGCTGAGACGGGACATGGTCCTCAATTACAAATGGGCG
CCCCAGGACGGCCTGGAGCGAGGCATGATCGTTACGCTGAGGTGAGAGAGAGAGAGAGAGGCTGGCTTCGGGGGA
CAGGTCCGCGCAGCCAGCCAGCCAACAGGCCGGCCAGCCAACAGAGAGTGCCCCAGCCGCGCGGGAGAGACGGAG
ACGCTGACTGCGACGACCTCGTCCGCGCCAGGAGCCCGTTACGGCCGGAAGCCGTCGTCGTCAAGAGAGTGGTGG
CGCTGGAGGGAGACGTCGTCCAGACCAAGGCGCCGTATCCGATCCCAACCGTCCGCATCCCCCAGGGCCACGTCT
GGGTCGAGGGAGACGGCCCGCCGAGGTCGAGCCTGGACAGCAACACGTACGGCCCGGTCTCCAAGAGACTTCTCA
CGGGCCGCGTGACTCATTTCGTCTACCCCTTGAGGAAATTCGGGCCGGTGCGGTGGTGGGAGCACGAGAGACGGC
AGCCGTTGGTGCTGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail