Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8101
Gene name
LocationContig_509:5013..7199
Strand+
Gene length (bp)2186
Transcript length (bp)2016
Coding sequence length (bp)2016
Protein length (aa) 672

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 1.8E-32 147 304
PF11987 IF-2 Translation-initiation factor 2 1.1E-26 466 557
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.5E-09 147 253

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25038|IF2M_YEAST Translation initiation factor IF-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IFM1 PE=1 SV=2 50 671 1.0E-155
sp|Q0HXR5|IF2_SHESR Translation initiation factor IF-2 OS=Shewanella sp. (strain MR-7) GN=infB PE=3 SV=1 62 671 1.0E-144
sp|Q0HLG1|IF2_SHESM Translation initiation factor IF-2 OS=Shewanella sp. (strain MR-4) GN=infB PE=3 SV=1 62 671 1.0E-144
sp|A0KNE3|IF2_AERHH Translation initiation factor IF-2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=infB PE=3 SV=1 62 671 5.0E-144
sp|O59683|IF2M_SCHPO Translation initiation factor IF-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.15c PE=3 SV=1 61 664 5.0E-144
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25038|IF2M_YEAST Translation initiation factor IF-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IFM1 PE=1 SV=2 50 671 1.0E-155
sp|Q0HXR5|IF2_SHESR Translation initiation factor IF-2 OS=Shewanella sp. (strain MR-7) GN=infB PE=3 SV=1 62 671 1.0E-144
sp|Q0HLG1|IF2_SHESM Translation initiation factor IF-2 OS=Shewanella sp. (strain MR-4) GN=infB PE=3 SV=1 62 671 1.0E-144
sp|A0KNE3|IF2_AERHH Translation initiation factor IF-2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=infB PE=3 SV=1 62 671 5.0E-144
sp|O59683|IF2M_SCHPO Translation initiation factor IF-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.15c PE=3 SV=1 61 664 5.0E-144
sp|A0KTZ6|IF2_SHESA Translation initiation factor IF-2 OS=Shewanella sp. (strain ANA-3) GN=infB PE=3 SV=1 62 671 1.0E-143
sp|A4SJR5|IF2_AERS4 Translation initiation factor IF-2 OS=Aeromonas salmonicida (strain A449) GN=infB PE=3 SV=1 62 671 2.0E-143
sp|Q8EHL5|IF2_SHEON Translation initiation factor IF-2 OS=Shewanella oneidensis (strain MR-1) GN=infB PE=3 SV=1 62 671 7.0E-143
sp|A1RGX5|IF2_SHESW Translation initiation factor IF-2 OS=Shewanella sp. (strain W3-18-1) GN=infB PE=3 SV=1 62 671 9.0E-143
sp|A4Y9C0|IF2_SHEPC Translation initiation factor IF-2 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=infB PE=3 SV=1 62 671 9.0E-143
sp|Q5QTY8|IF2_IDILO Translation initiation factor IF-2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=infB PE=3 SV=1 37 671 2.0E-142
sp|A5UBT6|IF2_HAEIE Translation initiation factor IF-2 OS=Haemophilus influenzae (strain PittEE) GN=infB PE=3 SV=1 62 671 3.0E-142
sp|P44323|IF2_HAEIN Translation initiation factor IF-2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=infB PE=3 SV=1 62 671 4.0E-142
sp|B4RC55|IF2_PHEZH Translation initiation factor IF-2 OS=Phenylobacterium zucineum (strain HLK1) GN=infB PE=3 SV=1 62 671 5.0E-142
sp|A9KZX1|IF2_SHEB9 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS195) GN=infB PE=3 SV=1 62 671 5.0E-141
sp|A6WRG8|IF2_SHEB8 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS185) GN=infB PE=3 SV=1 62 671 5.0E-141
sp|A3D7K6|IF2_SHEB5 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=infB PE=3 SV=1 62 671 5.0E-141
sp|B8E6N2|IF2_SHEB2 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS223) GN=infB PE=3 SV=1 62 671 5.0E-141
sp|Q4QK37|IF2_HAEI8 Translation initiation factor IF-2 OS=Haemophilus influenzae (strain 86-028NP) GN=infB PE=3 SV=1 62 671 9.0E-141
sp|A7HZ93|IF2_PARL1 Translation initiation factor IF-2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=infB PE=3 SV=1 62 671 1.0E-140
sp|A1S462|IF2_SHEAM Translation initiation factor IF-2 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=infB PE=3 SV=1 62 671 1.0E-140
sp|A5UF34|IF2_HAEIG Translation initiation factor IF-2 OS=Haemophilus influenzae (strain PittGG) GN=infB PE=3 SV=1 62 671 1.0E-140
sp|B0BNR5|IF2_ACTPJ Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=infB PE=3 SV=1 62 671 3.0E-140
sp|B3H163|IF2_ACTP7 Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=infB PE=3 SV=1 62 671 1.0E-139
sp|A3N005|IF2_ACTP2 Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=infB PE=3 SV=1 62 671 1.0E-139
sp|A3QGU5|IF2_SHELP Translation initiation factor IF-2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=infB PE=3 SV=1 62 671 6.0E-139
sp|P57873|IF2_PASMU Translation initiation factor IF-2 OS=Pasteurella multocida (strain Pm70) GN=infB PE=3 SV=1 62 671 3.0E-138
sp|Q2RMS0|IF2_RHORT Translation initiation factor IF-2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=infB PE=3 SV=2 5 663 3.0E-138
sp|Q0I3P5|IF2_HAES1 Translation initiation factor IF-2 OS=Haemophilus somnus (strain 129Pt) GN=infB PE=3 SV=1 10 671 4.0E-138
sp|B0UU13|IF2_HISS2 Translation initiation factor IF-2 OS=Histophilus somni (strain 2336) GN=infB PE=3 SV=1 10 671 4.0E-138
sp|A8FYS0|IF2_SHESH Translation initiation factor IF-2 OS=Shewanella sediminis (strain HAW-EB3) GN=infB PE=3 SV=1 62 671 5.0E-138
sp|A6VNE0|IF2_ACTSZ Translation initiation factor IF-2 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=infB PE=3 SV=1 21 671 8.0E-138
sp|C1D8X2|IF2_LARHH Translation initiation factor IF-2 OS=Laribacter hongkongensis (strain HLHK9) GN=infB PE=3 SV=1 17 671 2.0E-137
sp|Q9ZF28|IF2_KLEOX Translation initiation factor IF-2 OS=Klebsiella oxytoca GN=infB PE=3 SV=1 62 671 2.0E-137
sp|Q086H2|IF2_SHEFN Translation initiation factor IF-2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=infB PE=3 SV=1 62 671 8.0E-137
sp|Q12QI1|IF2_SHEDO Translation initiation factor IF-2 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=infB PE=3 SV=1 62 671 8.0E-137
sp|B0TQA2|IF2_SHEHH Translation initiation factor IF-2 OS=Shewanella halifaxensis (strain HAW-EB4) GN=infB PE=3 SV=1 62 671 1.0E-136
sp|Q5LWL4|IF2_RUEPO Translation initiation factor IF-2 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=infB PE=3 SV=1 10 671 1.0E-136
sp|B0T167|IF2_CAUSK Translation initiation factor IF-2 OS=Caulobacter sp. (strain K31) GN=infB PE=3 SV=1 62 668 1.0E-136
sp|Q9ZF25|IF2_ENTCL Translation initiation factor IF-2 OS=Enterobacter cloacae GN=infB PE=3 SV=1 62 671 2.0E-136
sp|A1UU50|IF2_BARBK Translation initiation factor IF-2 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=infB PE=3 SV=1 31 662 2.0E-136
sp|Q7VLI2|IF2_HAEDU Translation initiation factor IF-2 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=infB PE=3 SV=1 51 671 2.0E-136
sp|C4L8X4|IF2_TOLAT Translation initiation factor IF-2 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=infB PE=3 SV=1 39 671 2.0E-136
sp|B2T381|IF2_BURPP Translation initiation factor IF-2 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=infB PE=3 SV=1 16 671 3.0E-136
sp|Q140U6|IF2_BURXL Translation initiation factor IF-2 OS=Burkholderia xenovorans (strain LB400) GN=infB PE=3 SV=1 16 671 4.0E-136
sp|Q65SK9|IF2_MANSM Translation initiation factor IF-2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=infB PE=3 SV=1 62 671 7.0E-136
sp|A3NUL0|IF2_BURP0 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 1106a) GN=infB PE=3 SV=1 16 671 1.0E-135
sp|Q63TP8|IF2_BURPS Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain K96243) GN=infB PE=3 SV=1 16 671 1.0E-135
sp|A3N8V8|IF2_BURP6 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 668) GN=infB PE=3 SV=1 16 671 1.0E-135
sp|Q3JSY9|IF2_BURP1 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 1710b) GN=infB PE=3 SV=1 16 671 1.0E-135
sp|Q2SVG8|IF2_BURTA Translation initiation factor IF-2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=infB PE=3 SV=1 16 671 2.0E-135
sp|Q16D38|IF2_ROSDO Translation initiation factor IF-2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=infB PE=3 SV=1 38 671 4.0E-135
sp|Q482T9|IF2_COLP3 Translation initiation factor IF-2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=infB PE=3 SV=1 62 671 5.0E-135
sp|A1V3N4|IF2_BURMS Translation initiation factor IF-2 OS=Burkholderia mallei (strain SAVP1) GN=infB PE=3 SV=1 16 671 6.0E-135
sp|Q62KK9|IF2_BURMA Translation initiation factor IF-2 OS=Burkholderia mallei (strain ATCC 23344) GN=infB PE=3 SV=1 16 671 6.0E-135
sp|A2S2L1|IF2_BURM9 Translation initiation factor IF-2 OS=Burkholderia mallei (strain NCTC 10229) GN=infB PE=3 SV=1 16 671 6.0E-135
sp|A3MJW4|IF2_BURM7 Translation initiation factor IF-2 OS=Burkholderia mallei (strain NCTC 10247) GN=infB PE=3 SV=1 16 671 6.0E-135
sp|Q8RA37|IF2_CALS4 Translation initiation factor IF-2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=infB PE=3 SV=1 50 662 8.0E-135
sp|A1ST45|IF2_PSYIN Translation initiation factor IF-2 OS=Psychromonas ingrahamii (strain 37) GN=infB PE=3 SV=1 50 671 9.0E-135
sp|Q11BC8|IF2_CHESB Translation initiation factor IF-2 OS=Chelativorans sp. (strain BNC1) GN=infB PE=3 SV=1 42 662 1.0E-134
sp|A9IMT5|IF2_BART1 Translation initiation factor IF-2 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=infB PE=3 SV=1 31 662 2.0E-134
sp|A4JDX1|IF2_BURVG Translation initiation factor IF-2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=infB PE=3 SV=1 16 671 2.0E-134
sp|A9ABD5|IF2_BURM1 Translation initiation factor IF-2 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=infB PE=3 SV=1 16 671 3.0E-134
sp|B3PI96|IF2_CELJU Translation initiation factor IF-2 OS=Cellvibrio japonicus (strain Ueda107) GN=infB PE=3 SV=1 24 667 3.0E-134
sp|Q0BPG2|IF2_GRABC Translation initiation factor IF-2 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=infB PE=3 SV=1 62 663 3.0E-134
sp|Q0BFY3|IF2_BURCM Translation initiation factor IF-2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=infB PE=3 SV=1 16 671 4.0E-134
sp|Q1LLR6|IF2_CUPMC Translation initiation factor IF-2 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=infB PE=3 SV=1 62 671 4.0E-134
sp|B2JKT4|IF2_BURP8 Translation initiation factor IF-2 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=infB PE=3 SV=1 16 671 5.0E-134
sp|B1KRR0|IF2_SHEWM Translation initiation factor IF-2 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=infB PE=3 SV=1 62 671 5.0E-134
sp|A1U600|IF2_MARHV Translation initiation factor IF-2 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=infB PE=3 SV=1 64 671 5.0E-134
sp|B1ZDQ8|IF2_METPB Translation initiation factor IF-2 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=infB PE=3 SV=1 62 671 6.0E-134
sp|A5FV21|IF2_ACICJ Translation initiation factor IF-2 OS=Acidiphilium cryptum (strain JF-5) GN=infB PE=3 SV=1 62 663 7.0E-134
sp|B4RXT8|IF2_ALTMD Translation initiation factor IF-2 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=infB PE=3 SV=1 68 671 1.0E-133
sp|A8H740|IF2_SHEPA Translation initiation factor IF-2 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=infB PE=3 SV=1 62 671 1.0E-133
sp|B1YP36|IF2_BURA4 Translation initiation factor IF-2 OS=Burkholderia ambifaria (strain MC40-6) GN=infB PE=3 SV=1 16 671 1.0E-133
sp|A8G907|IF2_SERP5 Translation initiation factor IF-2 OS=Serratia proteamaculans (strain 568) GN=infB PE=3 SV=1 62 671 2.0E-133
sp|Q5E7L5|IF2_VIBF1 Translation initiation factor IF-2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=infB PE=3 SV=1 62 671 2.0E-133
sp|Q3J9B6|IF2_NITOC Translation initiation factor IF-2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=infB PE=3 SV=1 58 671 2.0E-133
sp|B8CKH3|IF2_SHEPW Translation initiation factor IF-2 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=infB PE=3 SV=1 62 671 2.0E-133
sp|Q39H30|IF2_BURL3 Translation initiation factor IF-2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=infB PE=3 SV=1 16 671 3.0E-133
sp|B4E7L1|IF2_BURCJ Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=infB PE=3 SV=1 16 671 4.0E-133
sp|B5FA79|IF2_VIBFM Translation initiation factor IF-2 OS=Vibrio fischeri (strain MJ11) GN=infB PE=3 SV=1 62 671 4.0E-133
sp|Q8DBW0|IF2_VIBVU Translation initiation factor IF-2 OS=Vibrio vulnificus (strain CMCP6) GN=infB PE=3 SV=1 42 671 6.0E-133
sp|B8EIA7|IF2_METSB Translation initiation factor IF-2 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=infB PE=3 SV=1 39 671 7.0E-133
sp|Q1GXD6|IF2_METFK Translation initiation factor IF-2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=infB PE=3 SV=1 7 671 7.0E-133
sp|Q7NY13|IF2_CHRVO Translation initiation factor IF-2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=infB PE=3 SV=1 11 671 1.0E-132
sp|B1K0M0|IF2_BURCC Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain MC0-3) GN=infB PE=3 SV=1 16 671 1.0E-132
sp|A0K6X5|IF2_BURCH Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain HI2424) GN=infB PE=3 SV=1 16 671 1.0E-132
sp|Q1BWS7|IF2_BURCA Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain AU 1054) GN=infB PE=3 SV=1 16 671 1.0E-132
sp|B3R1E4|IF2_CUPTR Translation initiation factor IF-2 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=infB PE=3 SV=1 62 671 2.0E-132
sp|Q7MI09|IF2_VIBVY Translation initiation factor IF-2 OS=Vibrio vulnificus (strain YJ016) GN=infB PE=3 SV=1 42 671 3.0E-132
sp|Q15V72|IF2_PSEA6 Translation initiation factor IF-2 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=infB PE=3 SV=1 66 671 3.0E-132
sp|A4WW80|IF2_RHOS5 Translation initiation factor IF-2 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=infB PE=3 SV=1 31 671 3.0E-132
sp|Q5FQM3|IF2_GLUOX Translation initiation factor IF-2 OS=Gluconobacter oxydans (strain 621H) GN=infB PE=3 SV=1 62 663 4.0E-132
sp|C0QTL9|IF2_PERMH Translation initiation factor IF-2 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=infB PE=3 SV=1 63 668 5.0E-132
sp|Q3IYN5|IF2_RHOS4 Translation initiation factor IF-2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=infB PE=3 SV=1 31 671 5.0E-132
sp|A3PNL2|IF2_RHOS1 Translation initiation factor IF-2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=infB PE=3 SV=1 31 671 6.0E-132
sp|B7GG75|IF2_ANOFW Translation initiation factor IF-2 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=infB PE=3 SV=1 68 662 8.0E-132
sp|Q835U8|IF2_ENTFA Translation initiation factor IF-2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=infB PE=3 SV=1 66 667 9.0E-132
sp|Q0K9B9|IF2_CUPNH Translation initiation factor IF-2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=infB PE=3 SV=1 62 671 9.0E-132
sp|A8IG20|IF2_AZOC5 Translation initiation factor IF-2 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=infB PE=3 SV=1 7 671 9.0E-132
sp|Q98BI8|IF2_RHILO Translation initiation factor IF-2 OS=Rhizobium loti (strain MAFF303099) GN=infB PE=3 SV=1 62 662 1.0E-131
sp|C3LSP8|IF2_VIBCM Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=infB PE=3 SV=1 66 671 1.0E-131
sp|Q9KU80|IF2_VIBCH Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=infB PE=3 SV=1 66 671 1.0E-131
sp|A5F926|IF2_VIBC3 Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=infB PE=3 SV=1 66 671 1.0E-131
sp|Q6G4W7|IF2_BARHE Translation initiation factor IF-2 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=infB PE=3 SV=1 31 662 1.0E-131
sp|A4WEY3|IF2_ENT38 Translation initiation factor IF-2 OS=Enterobacter sp. (strain 638) GN=infB PE=3 SV=1 62 671 1.0E-131
sp|A7MZI5|IF2_VIBCB Translation initiation factor IF-2 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=infB PE=3 SV=1 62 671 2.0E-131
sp|Q1GCH2|IF2_RUEST Translation initiation factor IF-2 OS=Ruegeria sp. (strain TM1040) GN=infB PE=3 SV=1 31 671 2.0E-131
sp|A5IHU7|IF2_LEGPC Translation initiation factor IF-2 OS=Legionella pneumophila (strain Corby) GN=infB PE=3 SV=1 58 671 2.0E-131
sp|C5BFB7|IF2_EDWI9 Translation initiation factor IF-2 OS=Edwardsiella ictaluri (strain 93-146) GN=infB PE=3 SV=1 62 671 3.0E-131
sp|A8LQ56|IF2_DINSH Translation initiation factor IF-2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=infB PE=3 SV=1 31 671 4.0E-131
sp|Q5X1C3|IF2_LEGPA Translation initiation factor IF-2 OS=Legionella pneumophila (strain Paris) GN=infB PE=3 SV=1 58 671 4.0E-131
sp|B7VJH7|IF2_VIBTL Translation initiation factor IF-2 OS=Vibrio tasmaniensis (strain LGP32) GN=infB PE=3 SV=1 45 671 5.0E-131
sp|A1B587|IF2_PARDP Translation initiation factor IF-2 OS=Paracoccus denitrificans (strain Pd 1222) GN=infB PE=3 SV=1 31 671 5.0E-131
sp|Q6G0P2|IF2_BARQU Translation initiation factor IF-2 OS=Bartonella quintana (strain Toulouse) GN=infB PE=3 SV=1 31 662 6.0E-131
sp|Q3IJ53|IF2_PSEHT Translation initiation factor IF-2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=infB PE=3 SV=1 57 671 7.0E-131
sp|A5EWY9|IF2_DICNV Translation initiation factor IF-2 OS=Dichelobacter nodosus (strain VCS1703A) GN=infB PE=3 SV=1 58 671 8.0E-131
sp|Q5WT36|IF2_LEGPL Translation initiation factor IF-2 OS=Legionella pneumophila (strain Lens) GN=infB PE=3 SV=1 58 671 9.0E-131
sp|Q28WF7|IF2_JANSC Translation initiation factor IF-2 OS=Jannaschia sp. (strain CCS1) GN=infB PE=3 SV=1 31 671 9.0E-131
sp|Q5ZRV4|IF2_LEGPH Translation initiation factor IF-2 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=infB PE=3 SV=1 58 671 9.0E-131
sp|Q0A797|IF2_ALKEH Translation initiation factor IF-2 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=infB PE=3 SV=1 62 671 1.0E-130
sp|Q8UJ51|IF2_AGRFC Translation initiation factor IF-2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=infB PE=3 SV=1 62 662 1.0E-130
sp|Q2KDZ5|IF2_RHIEC Translation initiation factor IF-2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=infB PE=3 SV=1 31 662 2.0E-130
sp|B3ELN8|IF2_CHLPB Translation initiation factor IF-2 OS=Chlorobium phaeobacteroides (strain BS1) GN=infB PE=3 SV=1 62 671 3.0E-130
sp|Q9AC25|IF2_CAUCR Translation initiation factor IF-2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=infB PE=3 SV=2 38 668 3.0E-130
sp|Q1MN39|IF2_RHIL3 Translation initiation factor IF-2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=infB PE=3 SV=1 20 662 4.0E-130
sp|B0K9Q0|IF2_THEP3 Translation initiation factor IF-2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=infB PE=3 SV=1 54 663 5.0E-130
sp|Q1QSZ0|IF2_CHRSD Translation initiation factor IF-2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=infB PE=3 SV=1 62 671 6.0E-130
sp|B3PXE3|IF2_RHIE6 Translation initiation factor IF-2 OS=Rhizobium etli (strain CIAT 652) GN=infB PE=3 SV=1 31 662 7.0E-130
sp|A1AV99|IF2_RUTMC Translation initiation factor IF-2 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=infB PE=3 SV=1 34 671 1.0E-129
sp|Q8FXT2|IF2_BRUSU Translation initiation factor IF-2 OS=Brucella suis biovar 1 (strain 1330) GN=infB PE=3 SV=1 62 662 1.0E-129
sp|Q46ZP1|IF2_CUPPJ Translation initiation factor IF-2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=infB PE=3 SV=1 62 671 1.0E-129
sp|Q8YEB3|IF2_BRUME Translation initiation factor IF-2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=infB PE=3 SV=2 62 662 1.0E-129
sp|B0CK11|IF2_BRUSI Translation initiation factor IF-2 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=infB PE=3 SV=1 62 662 1.0E-129
sp|Q57AA0|IF2_BRUAB Translation initiation factor IF-2 OS=Brucella abortus biovar 1 (strain 9-941) GN=infB PE=3 SV=1 62 662 1.0E-129
sp|Q2YQR7|IF2_BRUA2 Translation initiation factor IF-2 OS=Brucella abortus (strain 2308) GN=infB PE=3 SV=1 62 662 1.0E-129
sp|B2UAA3|IF2_RALPJ Translation initiation factor IF-2 OS=Ralstonia pickettii (strain 12J) GN=infB PE=3 SV=1 62 671 1.0E-129
sp|A7MQE1|IF2_CROS8 Translation initiation factor IF-2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=infB PE=3 SV=1 62 671 2.0E-129
sp|Q8XZV6|IF2_RALSO Translation initiation factor IF-2 OS=Ralstonia solanacearum (strain GMI1000) GN=infB PE=3 SV=1 62 671 2.0E-129
sp|A8GSP4|IF2_RICRS Translation initiation factor IF-2 OS=Rickettsia rickettsii (strain Sheila Smith) GN=infB PE=3 SV=1 62 671 3.0E-129
sp|B0BY61|IF2_RICRO Translation initiation factor IF-2 OS=Rickettsia rickettsii (strain Iowa) GN=infB PE=3 SV=1 62 671 3.0E-129
sp|A5CXX6|IF2_VESOH Translation initiation factor IF-2 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=infB PE=3 SV=1 34 671 3.0E-129
sp|Q0C5Z5|IF2_HYPNA Translation initiation factor IF-2 OS=Hyphomonas neptunium (strain ATCC 15444) GN=infB PE=3 SV=1 56 671 3.0E-129
sp|Q2VZV0|IF2_MAGSA Translation initiation factor IF-2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=infB PE=3 SV=1 24 663 3.0E-129
sp|B4S4S6|IF2_PROA2 Translation initiation factor IF-2 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=infB PE=3 SV=1 64 671 3.0E-129
sp|B9DPF5|IF2_STACT Translation initiation factor IF-2 OS=Staphylococcus carnosus (strain TM300) GN=infB PE=3 SV=1 50 669 4.0E-129
sp|B0K1D6|IF2_THEPX Translation initiation factor IF-2 OS=Thermoanaerobacter sp. (strain X514) GN=infB PE=3 SV=1 64 663 4.0E-129
sp|Q47D94|IF2_DECAR Translation initiation factor IF-2 OS=Dechloromonas aromatica (strain RCB) GN=infB PE=3 SV=1 17 671 4.0E-129
sp|A4IMD7|IF2_GEOTN Translation initiation factor IF-2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=infB PE=3 SV=1 50 662 4.0E-129
sp|A9M9Z4|IF2_BRUC2 Translation initiation factor IF-2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=infB PE=3 SV=1 62 662 4.0E-129
sp|Q6NCN5|IF2_RHOPA Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=infB PE=3 SV=1 62 671 4.0E-129
sp|C5D9C9|IF2_GEOSW Translation initiation factor IF-2 OS=Geobacillus sp. (strain WCH70) GN=infB PE=3 SV=1 54 668 5.0E-129
sp|Q92HF5|IF2_RICCN Translation initiation factor IF-2 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=infB PE=3 SV=1 62 671 6.0E-129
sp|Q92SW4|IF2_RHIME Translation initiation factor IF-2 OS=Rhizobium meliloti (strain 1021) GN=infB PE=3 SV=1 6 662 6.0E-129
sp|B6ENE2|IF2_ALISL Translation initiation factor IF-2 OS=Aliivibrio salmonicida (strain LFI1238) GN=infB PE=3 SV=1 62 671 7.0E-129
sp|Q89WA9|IF2_BRADU Translation initiation factor IF-2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=infB PE=3 SV=1 62 671 8.0E-129
sp|Q7MYY7|IF2_PHOLL Translation initiation factor IF-2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=infB PE=3 SV=1 10 671 8.0E-129
sp|Q21C31|IF2_RHOPB Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisB18) GN=infB PE=3 SV=1 25 671 9.0E-129
sp|A1WXV1|IF2_HALHL Translation initiation factor IF-2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=infB PE=3 SV=1 50 671 1.0E-128
sp|A5VTB2|IF2_BRUO2 Translation initiation factor IF-2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=infB PE=3 SV=2 62 662 1.0E-128
sp|Q2SML3|IF2_HAHCH Translation initiation factor IF-2 OS=Hahella chejuensis (strain KCTC 2396) GN=infB PE=3 SV=1 24 671 1.0E-128
sp|P04766|IF2_GEOSE Translation initiation factor IF-2 OS=Geobacillus stearothermophilus GN=infB PE=1 SV=1 50 662 1.0E-128
sp|Q11PK5|IF2_CYTH3 Translation initiation factor IF-2 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=infB PE=3 SV=1 21 671 1.0E-128
sp|B9JYK6|IF2_AGRVS Translation initiation factor IF-2 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=infB PE=3 SV=1 62 662 2.0E-128
sp|A8F223|IF2_RICM5 Translation initiation factor IF-2 OS=Rickettsia massiliae (strain Mtu5) GN=infB PE=3 SV=1 62 671 2.0E-128
sp|Q2Y7W2|IF2_NITMU Translation initiation factor IF-2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=infB PE=3 SV=1 62 663 2.0E-128
sp|A8GW31|IF2_RICB8 Translation initiation factor IF-2 OS=Rickettsia bellii (strain OSU 85-389) GN=infB PE=3 SV=1 6 671 2.0E-128
sp|B5XSX4|IF2_KLEP3 Translation initiation factor IF-2 OS=Klebsiella pneumoniae (strain 342) GN=infB PE=3 SV=1 62 671 2.0E-128
sp|A4IW10|IF2_FRATW Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=infB PE=3 SV=1 64 667 3.0E-128
sp|Q9ZF31|IF2_SALTY Translation initiation factor IF-2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=infB PE=3 SV=2 62 671 3.0E-128
sp|C0PZ54|IF2_SALPC Translation initiation factor IF-2 OS=Salmonella paratyphi C (strain RKS4594) GN=infB PE=3 SV=1 62 671 3.0E-128
sp|A9N732|IF2_SALPB Translation initiation factor IF-2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=infB PE=3 SV=1 62 671 3.0E-128
sp|B4T6Z8|IF2_SALNS Translation initiation factor IF-2 OS=Salmonella newport (strain SL254) GN=infB PE=3 SV=1 62 671 3.0E-128
sp|B4TJ06|IF2_SALHS Translation initiation factor IF-2 OS=Salmonella heidelberg (strain SL476) GN=infB PE=3 SV=1 62 671 3.0E-128
sp|B5QZV8|IF2_SALEP Translation initiation factor IF-2 OS=Salmonella enteritidis PT4 (strain P125109) GN=infB PE=3 SV=1 62 671 3.0E-128
sp|B5FI13|IF2_SALDC Translation initiation factor IF-2 OS=Salmonella dublin (strain CT_02021853) GN=infB PE=3 SV=1 62 671 3.0E-128
sp|B5F6T8|IF2_SALA4 Translation initiation factor IF-2 OS=Salmonella agona (strain SL483) GN=infB PE=3 SV=1 62 671 3.0E-128
sp|B4TWD8|IF2_SALSV Translation initiation factor IF-2 OS=Salmonella schwarzengrund (strain CVM19633) GN=infB PE=3 SV=1 62 671 3.0E-128
sp|B5REN6|IF2_SALG2 Translation initiation factor IF-2 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=infB PE=3 SV=1 62 671 3.0E-128
sp|A6TEI7|IF2_KLEP7 Translation initiation factor IF-2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=infB PE=3 SV=1 62 671 3.0E-128
sp|Q0AK69|IF2_MARMM Translation initiation factor IF-2 OS=Maricaulis maris (strain MCS10) GN=infB PE=3 SV=1 31 671 4.0E-128
sp|Q57JH9|IF2_SALCH Translation initiation factor IF-2 OS=Salmonella choleraesuis (strain SC-B67) GN=infB PE=3 SV=1 62 671 4.0E-128
sp|Q87M02|IF2_VIBPA Translation initiation factor IF-2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=infB PE=3 SV=1 62 671 4.0E-128
sp|Q0BK70|IF2_FRATO Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=infB PE=3 SV=1 64 671 4.0E-128
sp|A7NEI8|IF2_FRATF Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=infB PE=3 SV=1 64 671 4.0E-128
sp|Q2A1G8|IF2_FRATH Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=infB PE=3 SV=1 64 671 5.0E-128
sp|A4SY78|IF2_POLSQ Translation initiation factor IF-2 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=infB PE=3 SV=1 62 671 5.0E-128
sp|Q1RIX0|IF2_RICBR Translation initiation factor IF-2 OS=Rickettsia bellii (strain RML369-C) GN=infB PE=3 SV=1 6 671 5.0E-128
sp|B5BGJ5|IF2_SALPK Translation initiation factor IF-2 OS=Salmonella paratyphi A (strain AKU_12601) GN=infB PE=3 SV=1 62 671 5.0E-128
sp|Q5PLB0|IF2_SALPA Translation initiation factor IF-2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=infB PE=3 SV=1 62 671 5.0E-128
sp|Q5NIL7|IF2_FRATT Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=infB PE=3 SV=1 64 671 5.0E-128
sp|Q14K20|IF2_FRAT1 Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=infB PE=3 SV=1 64 671 5.0E-128
sp|A6UF29|IF2_SINMW Translation initiation factor IF-2 OS=Sinorhizobium medicae (strain WSM419) GN=infB PE=3 SV=1 6 662 6.0E-128
sp|Q8Z3H7|IF2_SALTI Translation initiation factor IF-2 OS=Salmonella typhi GN=infB PE=3 SV=1 62 671 6.0E-128
sp|Q4UL51|IF2_RICFE Translation initiation factor IF-2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=infB PE=3 SV=1 62 671 7.0E-128
sp|Q9ZCZ8|IF2_RICPR Translation initiation factor IF-2 OS=Rickettsia prowazekii (strain Madrid E) GN=infB PE=3 SV=1 9 671 8.0E-128
sp|B2SEW7|IF2_FRATM Translation initiation factor IF-2 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=infB PE=3 SV=1 64 671 8.0E-128
sp|A0Q8F3|IF2_FRATN Translation initiation factor IF-2 OS=Francisella tularensis subsp. novicida (strain U112) GN=infB PE=3 SV=1 64 671 1.0E-127
sp|A0LE19|IF2_MAGMM Translation initiation factor IF-2 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=infB PE=3 SV=1 55 671 1.0E-127
sp|A6WWW5|IF2_OCHA4 Translation initiation factor IF-2 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=infB PE=3 SV=1 62 662 1.0E-127
sp|B1XV89|IF2_POLNS Translation initiation factor IF-2 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=infB PE=3 SV=1 62 671 1.0E-127
sp|A8GNW1|IF2_RICAH Translation initiation factor IF-2 OS=Rickettsia akari (strain Hartford) GN=infB PE=3 SV=1 5 671 2.0E-127
sp|Q04U31|IF2_LEPBJ Translation initiation factor IF-2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=infB PE=3 SV=1 59 671 2.0E-127
sp|A8AQ58|IF2_CITK8 Translation initiation factor IF-2 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=infB PE=3 SV=1 62 671 3.0E-127
sp|Q04ZJ5|IF2_LEPBL Translation initiation factor IF-2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=infB PE=3 SV=1 59 671 3.0E-127
sp|Q4FVL5|IF2_PSYA2 Translation initiation factor IF-2 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=infB PE=3 SV=1 34 663 3.0E-127
sp|Q74CT3|IF2_GEOSL Translation initiation factor IF-2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=infB PE=3 SV=1 62 663 3.0E-127
sp|Q68WI4|IF2_RICTY Translation initiation factor IF-2 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=infB PE=3 SV=1 62 671 4.0E-127
sp|A5E866|IF2_BRASB Translation initiation factor IF-2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=infB PE=3 SV=1 62 671 6.0E-127
sp|A7H9F3|IF2_ANADF Translation initiation factor IF-2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=infB PE=3 SV=1 62 671 8.0E-127
sp|Q1QEP5|IF2_PSYCK Translation initiation factor IF-2 OS=Psychrobacter cryohalolentis (strain K5) GN=infB PE=3 SV=1 34 663 9.0E-127
sp|Q8KFT1|IF2_CHLTE Translation initiation factor IF-2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=infB PE=3 SV=1 62 671 9.0E-127
sp|C4K3F0|IF2_HAMD5 Translation initiation factor IF-2 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=infB PE=3 SV=1 62 671 1.0E-126
sp|A9MP36|IF2_SALAR Translation initiation factor IF-2 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=infB PE=3 SV=1 62 671 1.0E-126
sp|B0TWR3|IF2_FRAP2 Translation initiation factor IF-2 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=infB PE=3 SV=1 62 671 1.0E-126
sp|A4YJE9|IF2_BRASO Translation initiation factor IF-2 OS=Bradyrhizobium sp. (strain ORS278) GN=infB PE=3 SV=1 62 671 2.0E-126
sp|A9ITX6|IF2_BORPD Translation initiation factor IF-2 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=infB PE=3 SV=1 35 671 2.0E-126
sp|B8GP02|IF2_THISH Translation initiation factor IF-2 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=infB PE=3 SV=1 58 671 2.0E-126
sp|Q6LUJ2|IF2_PHOPR Translation initiation factor IF-2 OS=Photobacterium profundum GN=infB PE=3 SV=1 43 671 2.0E-126
sp|Q3SWP9|IF2_NITWN Translation initiation factor IF-2 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=infB PE=3 SV=1 62 671 3.0E-126
sp|A6Q226|IF2_NITSB Translation initiation factor IF-2 OS=Nitratiruptor sp. (strain SB155-2) GN=infB PE=3 SV=1 140 671 3.0E-126
sp|Q609C0|IF2_METCA Translation initiation factor IF-2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=infB PE=3 SV=1 58 666 3.0E-126
sp|Q8K9H1|IF2_BUCAP Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=infB PE=3 SV=1 36 671 5.0E-126
sp|Q0T0B3|IF2_SHIF8 Translation initiation factor IF-2 OS=Shigella flexneri serotype 5b (strain 8401) GN=infB PE=3 SV=1 62 671 6.0E-126
sp|B7LR37|IF2_ESCF3 Translation initiation factor IF-2 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=infB PE=3 SV=1 62 671 7.0E-126
sp|Q83JF9|IF2_SHIFL Translation initiation factor IF-2 OS=Shigella flexneri GN=infB PE=3 SV=1 62 671 7.0E-126
sp|Q31W47|IF2_SHIBS Translation initiation factor IF-2 OS=Shigella boydii serotype 4 (strain Sb227) GN=infB PE=3 SV=1 62 671 7.0E-126
sp|Q8F7K1|IF2_LEPIN Translation initiation factor IF-2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=infB PE=3 SV=2 59 671 7.0E-126
sp|Q32BG5|IF2_SHIDS Translation initiation factor IF-2 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=infB PE=3 SV=1 62 671 8.0E-126
sp|Q3YX73|IF2_SHISS Translation initiation factor IF-2 OS=Shigella sonnei (strain Ss046) GN=infB PE=3 SV=1 62 671 8.0E-126
sp|B2U207|IF2_SHIB3 Translation initiation factor IF-2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=infB PE=3 SV=1 62 671 8.0E-126
sp|Q3SKX1|IF2_THIDA Translation initiation factor IF-2 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=infB PE=3 SV=1 18 671 8.0E-126
sp|B7N0V3|IF2_ECO81 Translation initiation factor IF-2 OS=Escherichia coli O81 (strain ED1a) GN=infB PE=3 SV=1 62 671 8.0E-126
sp|Q1R6H0|IF2_ECOUT Translation initiation factor IF-2 OS=Escherichia coli (strain UTI89 / UPEC) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|B6I1P3|IF2_ECOSE Translation initiation factor IF-2 OS=Escherichia coli (strain SE11) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|B7NDF4|IF2_ECOLU Translation initiation factor IF-2 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|P0A705|IF2_ECOLI Translation initiation factor IF-2 OS=Escherichia coli (strain K12) GN=infB PE=1 SV=1 62 671 9.0E-126
sp|B1IQV3|IF2_ECOLC Translation initiation factor IF-2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|P59587|IF2_ECOL6 Translation initiation factor IF-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|Q0TCU1|IF2_ECOL5 Translation initiation factor IF-2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|A1AG73|IF2_ECOK1 Translation initiation factor IF-2 OS=Escherichia coli O1:K1 / APEC GN=infB PE=3 SV=1 62 671 9.0E-126
sp|A8A4Y4|IF2_ECOHS Translation initiation factor IF-2 OS=Escherichia coli O9:H4 (strain HS) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|B1XGY0|IF2_ECODH Translation initiation factor IF-2 OS=Escherichia coli (strain K12 / DH10B) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|C4ZSQ9|IF2_ECOBW Translation initiation factor IF-2 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|B7M076|IF2_ECO8A Translation initiation factor IF-2 OS=Escherichia coli O8 (strain IAI1) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|B7NKN7|IF2_ECO7I Translation initiation factor IF-2 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|B5YS58|IF2_ECO5E Translation initiation factor IF-2 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|P0A706|IF2_ECO57 Translation initiation factor IF-2 OS=Escherichia coli O157:H7 GN=infB PE=3 SV=1 62 671 9.0E-126
sp|B7LHN3|IF2_ECO55 Translation initiation factor IF-2 OS=Escherichia coli (strain 55989 / EAEC) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|B7MB89|IF2_ECO45 Translation initiation factor IF-2 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|B7UJ63|IF2_ECO27 Translation initiation factor IF-2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|A7ZS65|IF2_ECO24 Translation initiation factor IF-2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=infB PE=3 SV=1 62 671 9.0E-126
sp|Q72NX3|IF2_LEPIC Translation initiation factor IF-2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=infB PE=3 SV=2 59 671 1.0E-125
sp|Q1QS64|IF2_NITHX Translation initiation factor IF-2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=infB PE=3 SV=1 62 671 1.0E-125
sp|A5GVG4|IF2_SYNR3 Translation initiation factor IF-2 OS=Synechococcus sp. (strain RCC307) GN=infB PE=3 SV=1 143 671 1.0E-125
sp|B1LFS0|IF2_ECOSM Translation initiation factor IF-2 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=infB PE=3 SV=1 62 671 1.0E-125
sp|Q91YJ5|IF2M_MOUSE Translation initiation factor IF-2, mitochondrial OS=Mus musculus GN=Mtif2 PE=1 SV=2 129 666 1.0E-125
sp|A5VCZ5|IF2_SPHWW Translation initiation factor IF-2 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=infB PE=3 SV=1 6 671 2.0E-125
sp|B2SVK3|IF2_XANOP Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=infB PE=3 SV=1 28 671 2.0E-125
sp|Q0AFJ3|IF2_NITEC Translation initiation factor IF-2 OS=Nitrosomonas eutropha (strain C91) GN=infB PE=3 SV=1 62 671 2.0E-125
sp|Q4UWA2|IF2_XANC8 Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=infB PE=3 SV=2 43 671 2.0E-125
sp|Q5GXU9|IF2_XANOR Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=infB PE=3 SV=2 28 671 2.0E-125
sp|Q2P0X1|IF2_XANOM Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=infB PE=3 SV=1 28 671 2.0E-125
sp|Q1MQY8|IF2_LAWIP Translation initiation factor IF-2 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=infB PE=3 SV=1 10 671 2.0E-125
sp|B3QQI2|IF2_CHLP8 Translation initiation factor IF-2 OS=Chlorobaculum parvum (strain NCIB 8327) GN=infB PE=3 SV=1 62 671 3.0E-125
sp|A1VNU2|IF2_POLNA Translation initiation factor IF-2 OS=Polaromonas naphthalenivorans (strain CJ2) GN=infB PE=3 SV=1 60 671 3.0E-125
sp|A7GRE3|IF2_BACCN Translation initiation factor IF-2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=infB PE=3 SV=1 42 666 4.0E-125
sp|B0RRB4|IF2_XANCB Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=infB PE=3 SV=1 43 671 4.0E-125
sp|B2IIJ7|IF2_BEII9 Translation initiation factor IF-2 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=infB PE=3 SV=1 62 671 4.0E-125
sp|A1K7B9|IF2_AZOSB Translation initiation factor IF-2 OS=Azoarcus sp. (strain BH72) GN=infB PE=3 SV=1 46 671 5.0E-125
sp|Q8P7U7|IF2_XANCP Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=infB PE=3 SV=1 43 671 5.0E-125
sp|O67825|IF2_AQUAE Translation initiation factor IF-2 OS=Aquifex aeolicus (strain VF5) GN=infB PE=3 SV=1 62 671 6.0E-125
sp|Q2KXY7|IF2_BORA1 Translation initiation factor IF-2 OS=Bordetella avium (strain 197N) GN=infB PE=3 SV=1 21 671 6.0E-125
sp|A1BDF1|IF2_CHLPD Translation initiation factor IF-2 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=infB PE=3 SV=1 20 671 6.0E-125
sp|A5CEN6|IF2_ORITB Translation initiation factor IF-2 OS=Orientia tsutsugamushi (strain Boryong) GN=infB PE=3 SV=1 31 671 7.0E-125
sp|Q82WD0|IF2_NITEU Translation initiation factor IF-2 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=infB PE=3 SV=1 25 671 9.0E-125
sp|Q3B1Z8|IF2_CHLL7 Translation initiation factor IF-2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=infB PE=3 SV=1 20 671 1.0E-124
sp|Q7U8L9|IF2_SYNPX Translation initiation factor IF-2 OS=Synechococcus sp. (strain WH8102) GN=infB PE=3 SV=1 140 671 1.0E-124
sp|C5CLW3|IF2_VARPS Translation initiation factor IF-2 OS=Variovorax paradoxus (strain S110) GN=infB PE=3 SV=1 51 671 1.0E-124
sp|A4SGG2|IF2_CHLPM Translation initiation factor IF-2 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=infB PE=3 SV=1 20 671 1.0E-124
sp|Q493T7|IF2_BLOPB Translation initiation factor IF-2 OS=Blochmannia pennsylvanicus (strain BPEN) GN=infB PE=3 SV=1 11 666 1.0E-124
sp|Q2RJM5|IF2_MOOTA Translation initiation factor IF-2 OS=Moorella thermoacetica (strain ATCC 39073) GN=infB PE=3 SV=1 97 662 1.0E-124
sp|Q9ZF22|IF2_PROVU Translation initiation factor IF-2 OS=Proteus vulgaris GN=infB PE=3 SV=1 62 671 1.0E-124
sp|Q67P86|IF2_SYMTH Translation initiation factor IF-2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=infB PE=3 SV=1 97 663 2.0E-124
sp|Q73NP6|IF2_TREDE Translation initiation factor IF-2 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=infB PE=3 SV=1 50 671 2.0E-124
sp|Q39VA6|IF2_GEOMG Translation initiation factor IF-2 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=infB PE=3 SV=1 62 663 2.0E-124
sp|Q2J2J9|IF2_RHOP2 Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain HaA2) GN=infB PE=3 SV=1 62 671 3.0E-124
sp|B3QUN2|IF2_CHLT3 Translation initiation factor IF-2 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=infB PE=3 SV=1 64 671 3.0E-124
sp|B3EAE7|IF2_GEOLS Translation initiation factor IF-2 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=infB PE=3 SV=1 30 663 3.0E-124
sp|Q3BRP5|IF2_XANC5 Translation initiation factor IF-2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=infB PE=3 SV=1 28 671 3.0E-124
sp|P46198|IF2M_BOVIN Translation initiation factor IF-2, mitochondrial OS=Bos taurus GN=MTIF2 PE=1 SV=1 129 664 4.0E-124
sp|A9R5A3|IF2_YERPG Translation initiation factor IF-2 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=infB PE=3 SV=1 62 671 4.0E-124
sp|B9IVA1|IF2_BACCQ Translation initiation factor IF-2 OS=Bacillus cereus (strain Q1) GN=infB PE=3 SV=1 42 666 4.0E-124
sp|B7HLE6|IF2_BACC7 Translation initiation factor IF-2 OS=Bacillus cereus (strain AH187) GN=infB PE=3 SV=1 42 666 4.0E-124
sp|Q732Q9|IF2_BACC1 Translation initiation factor IF-2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=infB PE=3 SV=1 42 666 4.0E-124
sp|B8CW72|IF2_HALOH Translation initiation factor IF-2 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=infB PE=3 SV=1 125 671 5.0E-124
sp|Q1AW55|IF2_RUBXD Translation initiation factor IF-2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=infB PE=3 SV=1 73 669 5.0E-124
sp|Q5NQ27|IF2_ZYMMO Translation initiation factor IF-2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=infB PE=3 SV=1 38 671 6.0E-124
sp|C5BPV9|IF2_TERTT Translation initiation factor IF-2 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=infB PE=3 SV=1 64 667 7.0E-124
sp|B1XY67|IF2_LEPCP Translation initiation factor IF-2 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=infB PE=3 SV=1 62 671 7.0E-124
sp|Q81WM3|IF2_BACAN Translation initiation factor IF-2 OS=Bacillus anthracis GN=infB PE=3 SV=1 42 666 7.0E-124
sp|C3L7B4|IF2_BACAC Translation initiation factor IF-2 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=infB PE=3 SV=1 42 666 7.0E-124
sp|C3P5L5|IF2_BACAA Translation initiation factor IF-2 OS=Bacillus anthracis (strain A0248) GN=infB PE=3 SV=1 42 666 7.0E-124
sp|B4F2B9|IF2_PROMH Translation initiation factor IF-2 OS=Proteus mirabilis (strain HI4320) GN=infB PE=3 SV=1 62 671 8.0E-124
sp|B1JLY0|IF2_YERPY Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=infB PE=3 SV=1 62 671 9.0E-124
sp|Q66F60|IF2_YERPS Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=infB PE=3 SV=1 62 671 9.0E-124
sp|A4TRI3|IF2_YERPP Translation initiation factor IF-2 OS=Yersinia pestis (strain Pestoides F) GN=infB PE=3 SV=1 62 671 9.0E-124
sp|Q1CEL3|IF2_YERPN Translation initiation factor IF-2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=infB PE=3 SV=1 62 671 9.0E-124
sp|Q8ZBC2|IF2_YERPE Translation initiation factor IF-2 OS=Yersinia pestis GN=infB PE=3 SV=2 62 671 9.0E-124
sp|B2K2Q5|IF2_YERPB Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=infB PE=3 SV=1 62 671 9.0E-124
sp|A7FMS2|IF2_YERP3 Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=infB PE=3 SV=1 62 671 9.0E-124
sp|Q8PJ55|IF2_XANAC Translation initiation factor IF-2 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=infB PE=3 SV=1 28 671 1.0E-123
sp|A1W8Z4|IF2_ACISJ Translation initiation factor IF-2 OS=Acidovorax sp. (strain JS42) GN=infB PE=3 SV=1 50 663 1.0E-123
sp|B8D7R4|IF2_BUCAT Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=infB PE=3 SV=1 62 671 1.0E-123
sp|C1DFK9|IF2_AZOVD Translation initiation factor IF-2 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=infB PE=3 SV=1 62 671 1.0E-123
sp|B4UHG0|IF2_ANASK Translation initiation factor IF-2 OS=Anaeromyxobacter sp. (strain K) GN=infB PE=3 SV=1 62 663 1.0E-123
sp|Q21H61|IF2_SACD2 Translation initiation factor IF-2 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=infB PE=3 SV=1 64 667 1.0E-123
sp|Q6HF02|IF2_BACHK Translation initiation factor IF-2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=infB PE=3 SV=1 42 666 1.0E-123
sp|Q636L3|IF2_BACCZ Translation initiation factor IF-2 OS=Bacillus cereus (strain ZK / E33L) GN=infB PE=3 SV=1 42 666 1.0E-123
sp|C1EP35|IF2_BACC3 Translation initiation factor IF-2 OS=Bacillus cereus (strain 03BB102) GN=infB PE=3 SV=1 42 666 1.0E-123
sp|A0RHI4|IF2_BACAH Translation initiation factor IF-2 OS=Bacillus thuringiensis (strain Al Hakam) GN=infB PE=3 SV=2 42 666 1.0E-123
sp|Q812X7|IF2_BACCR Translation initiation factor IF-2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=infB PE=3 SV=1 42 666 1.0E-123
sp|B7HDT6|IF2_BACC4 Translation initiation factor IF-2 OS=Bacillus cereus (strain B4264) GN=infB PE=3 SV=1 42 666 1.0E-123
sp|A1AMM1|IF2_PELPD Translation initiation factor IF-2 OS=Pelobacter propionicus (strain DSM 2379) GN=infB PE=3 SV=1 62 663 1.0E-123
sp|Q1CC07|IF2_YERPA Translation initiation factor IF-2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=infB PE=3 SV=1 62 671 1.0E-123
sp|A5WBS5|IF2_PSYWF Translation initiation factor IF-2 OS=Psychrobacter sp. (strain PRwf-1) GN=infB PE=3 SV=1 62 663 1.0E-123
sp|A9KBM1|IF2_COXBN Translation initiation factor IF-2 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=infB PE=3 SV=1 7 671 1.0E-123
sp|A1JIW9|IF2_YERE8 Translation initiation factor IF-2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=infB PE=3 SV=1 62 671 1.0E-123
sp|B8JFY6|IF2_ANAD2 Translation initiation factor IF-2 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=infB PE=3 SV=1 62 663 1.0E-123
sp|P57458|IF2_BUCAI Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=infB PE=3 SV=1 62 671 1.0E-123
sp|B8D9G2|IF2_BUCA5 Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=infB PE=3 SV=1 62 671 1.0E-123
sp|Q07V78|IF2_RHOP5 Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisA53) GN=infB PE=3 SV=1 62 671 2.0E-123
sp|B8J1Y4|IF2_DESDA Translation initiation factor IF-2 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=infB PE=3 SV=1 62 671 2.0E-123
sp|Q4ZNR2|IF2_PSEU2 Translation initiation factor IF-2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=infB PE=3 SV=1 62 671 2.0E-123
sp|B4RMZ3|IF2_NEIG2 Translation initiation factor IF-2 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=infB PE=3 SV=1 62 671 2.0E-123
sp|C6DKK3|IF2_PECCP Translation initiation factor IF-2 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=infB PE=3 SV=1 62 671 3.0E-123
sp|B5E266|IF2_STRP4 Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=infB PE=3 SV=1 68 666 3.0E-123
sp|P46199|IF2M_HUMAN Translation initiation factor IF-2, mitochondrial OS=Homo sapiens GN=MTIF2 PE=1 SV=2 129 664 3.0E-123
sp|A8EYF4|IF2_RICCK Translation initiation factor IF-2 OS=Rickettsia canadensis (strain McKiel) GN=infB PE=3 SV=1 9 671 4.0E-123
sp|B8ZM93|IF2_STRPJ Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=infB PE=3 SV=1 68 666 5.0E-123
sp|B9KEV0|IF2_CAMLR Translation initiation factor IF-2 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=infB PE=3 SV=1 57 671 5.0E-123
sp|Q5NZS1|IF2_AROAE Translation initiation factor IF-2 OS=Aromatoleum aromaticum (strain EbN1) GN=infB PE=3 SV=1 62 671 6.0E-123
sp|C1CCT8|IF2_STRZJ Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain JJA) GN=infB PE=3 SV=1 68 666 6.0E-123
sp|Q8DQV2|IF2_STRR6 Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=infB PE=3 SV=1 68 666 6.0E-123
sp|Q04LW0|IF2_STRP2 Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=infB PE=3 SV=1 68 666 6.0E-123
sp|C1CQ48|IF2_STRZT Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=infB PE=3 SV=1 68 666 6.0E-123
sp|C1C5S8|IF2_STRP7 Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain 70585) GN=infB PE=3 SV=1 68 666 6.0E-123
sp|Q6D9A5|IF2_PECAS Translation initiation factor IF-2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=infB PE=3 SV=1 62 671 7.0E-123
sp|A6T0Y8|IF2_JANMA Translation initiation factor IF-2 OS=Janthinobacterium sp. (strain Marseille) GN=infB PE=3 SV=1 62 671 7.0E-123
sp|B2IME4|IF2_STRPS Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain CGSP14) GN=infB PE=3 SV=1 68 666 7.0E-123
sp|Q87WQ5|IF2_PSESM Translation initiation factor IF-2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=infB PE=3 SV=1 62 671 9.0E-123
sp|A7ZC69|IF2_CAMC1 Translation initiation factor IF-2 OS=Campylobacter concisus (strain 13826) GN=infB PE=3 SV=1 7 671 9.0E-123
sp|Q97I51|IF2_CLOAB Translation initiation factor IF-2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=infB PE=3 SV=1 142 669 9.0E-123
sp|B9EBE9|IF2_MACCJ Translation initiation factor IF-2 OS=Macrococcus caseolyticus (strain JCSC5402) GN=infB PE=3 SV=1 57 666 1.0E-122
sp|Q6FF40|IF2_ACIAD Translation initiation factor IF-2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=infB PE=3 SV=1 73 671 1.0E-122
sp|B6IZ61|IF2_COXB2 Translation initiation factor IF-2 OS=Coxiella burnetii (strain CbuG_Q212) GN=infB PE=3 SV=1 7 671 1.0E-122
sp|P17889|IF2_BACSU Translation initiation factor IF-2 OS=Bacillus subtilis (strain 168) GN=infB PE=3 SV=1 59 662 1.0E-122
sp|A8FDD1|IF2_BACP2 Translation initiation factor IF-2 OS=Bacillus pumilus (strain SAFR-032) GN=infB PE=3 SV=1 59 662 1.0E-122
sp|Q97S57|IF2_STRPN Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=infB PE=3 SV=1 68 666 1.0E-122
sp|Q2NW23|IF2_SODGM Translation initiation factor IF-2 OS=Sodalis glossinidius (strain morsitans) GN=infB PE=3 SV=1 62 671 1.0E-122
sp|B6J6B1|IF2_COXB1 Translation initiation factor IF-2 OS=Coxiella burnetii (strain CbuK_Q154) GN=infB PE=3 SV=1 7 671 2.0E-122
sp|A1KV51|IF2_NEIMF Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=infB PE=3 SV=1 62 671 2.0E-122
sp|A9M1D5|IF2_NEIM0 Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup C (strain 053442) GN=infB PE=3 SV=1 62 671 2.0E-122
sp|B0VE81|IF2_ACIBY Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AYE) GN=infB PE=3 SV=1 73 671 2.0E-122
sp|B2I2M7|IF2_ACIBC Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain ACICU) GN=infB PE=3 SV=1 73 671 2.0E-122
sp|B7I3R9|IF2_ACIB5 Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AB0057) GN=infB PE=3 SV=1 73 671 2.0E-122
sp|B7H115|IF2_ACIB3 Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AB307-0294) GN=infB PE=3 SV=1 73 671 2.0E-122
sp|Q7WHG2|IF2_BORBR Translation initiation factor IF-2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=infB PE=3 SV=1 62 671 2.0E-122
sp|Q13EL8|IF2_RHOPS Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisB5) GN=infB PE=3 SV=1 62 671 2.0E-122
sp|A1WLI3|IF2_VEREI Translation initiation factor IF-2 OS=Verminephrobacter eiseniae (strain EF01-2) GN=infB PE=3 SV=1 51 671 2.0E-122
sp|A4G7S7|IF2_HERAR Translation initiation factor IF-2 OS=Herminiimonas arsenicoxydans GN=infB PE=3 SV=1 62 671 2.0E-122
sp|B1IA80|IF2_STRPI Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=infB PE=3 SV=1 68 666 3.0E-122
sp|Q48E77|IF2_PSE14 Translation initiation factor IF-2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=infB PE=3 SV=1 62 671 3.0E-122
sp|Q3KI84|IF2_PSEPF Translation initiation factor IF-2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=infB PE=3 SV=1 62 671 3.0E-122
sp|B7IUH1|IF2_BACC2 Translation initiation factor IF-2 OS=Bacillus cereus (strain G9842) GN=infB PE=3 SV=1 42 666 3.0E-122
sp|Q5F797|IF2_NEIG1 Translation initiation factor IF-2 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=infB PE=3 SV=1 62 671 3.0E-122
sp|A4J5X2|IF2_DESRM Translation initiation factor IF-2 OS=Desulfotomaculum reducens (strain MI-1) GN=infB PE=3 SV=1 16 662 4.0E-122
sp|Q6GHG6|IF2_STAAR Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MRSA252) GN=infB PE=3 SV=1 51 669 4.0E-122
sp|B0VLU2|IF2_ACIBS Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain SDF) GN=infB PE=3 SV=1 73 671 4.0E-122
sp|Q7W9A5|IF2_BORPA Translation initiation factor IF-2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=infB PE=3 SV=1 62 671 4.0E-122
sp|A7I3V0|IF2_CAMHC Translation initiation factor IF-2 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=infB PE=3 SV=1 50 671 4.0E-122
sp|Q4KIF6|IF2_PSEF5 Translation initiation factor IF-2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=infB PE=3 SV=1 64 671 5.0E-122
sp|Q9JYD2|IF2_NEIMB Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup B (strain MC58) GN=infB PE=3 SV=1 62 671 5.0E-122
sp|A1TSK3|IF2_ACIAC Translation initiation factor IF-2 OS=Acidovorax citrulli (strain AAC00-1) GN=infB PE=3 SV=1 7 671 6.0E-122
sp|Q7VYR2|IF2_BORPE Translation initiation factor IF-2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=infB PE=3 SV=1 62 671 6.0E-122
sp|A4XYE0|IF2_PSEMY Translation initiation factor IF-2 OS=Pseudomonas mendocina (strain ymp) GN=infB PE=3 SV=1 40 671 7.0E-122
sp|C3K259|IF2_PSEFS Translation initiation factor IF-2 OS=Pseudomonas fluorescens (strain SBW25) GN=infB PE=3 SV=1 64 671 8.0E-122
sp|P65134|IF2_STAAN Translation initiation factor IF-2 OS=Staphylococcus aureus (strain N315) GN=infB PE=1 SV=1 59 669 1.0E-121
sp|P65133|IF2_STAAM Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=infB PE=3 SV=1 59 669 1.0E-121
sp|Q2YXP7|IF2_STAAB Translation initiation factor IF-2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=infB PE=3 SV=1 59 669 1.0E-121
sp|A5ISF3|IF2_STAA9 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain JH9) GN=infB PE=3 SV=1 59 669 1.0E-121
sp|A6U188|IF2_STAA2 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain JH1) GN=infB PE=3 SV=1 59 669 1.0E-121
sp|A7X1Q1|IF2_STAA1 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=infB PE=3 SV=1 59 669 1.0E-121
sp|C1CJ39|IF2_STRZP Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain P1031) GN=infB PE=3 SV=1 68 666 1.0E-121
sp|Q0VSS1|IF2_ALCBS Translation initiation factor IF-2 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=infB PE=3 SV=1 62 667 1.0E-121
sp|B1HR05|IF2_LYSSC Translation initiation factor IF-2 OS=Lysinibacillus sphaericus (strain C3-41) GN=infB PE=3 SV=1 54 666 1.0E-121
sp|A8Z3U9|IF2_STAAT Translation initiation factor IF-2 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=infB PE=3 SV=1 59 669 2.0E-121
sp|A6QGG8|IF2_STAAE Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Newman) GN=infB PE=3 SV=1 59 669 2.0E-121
sp|Q5HGG2|IF2_STAAC Translation initiation factor IF-2 OS=Staphylococcus aureus (strain COL) GN=infB PE=3 SV=1 59 669 2.0E-121
sp|Q2G2D0|IF2_STAA8 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain NCTC 8325) GN=infB PE=3 SV=1 59 669 2.0E-121
sp|Q2FHG9|IF2_STAA3 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain USA300) GN=infB PE=3 SV=1 59 669 2.0E-121
sp|Q8NWZ1|IF2_STAAW Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MW2) GN=infB PE=3 SV=1 59 669 2.0E-121
sp|Q6G9U4|IF2_STAAS Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MSSA476) GN=infB PE=3 SV=1 59 669 2.0E-121
sp|Q9JTB5|IF2_NEIMA Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=infB PE=3 SV=1 62 671 2.0E-121
sp|A5FJF9|IF2_FLAJ1 Translation initiation factor IF-2 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=infB PE=3 SV=1 31 671 2.0E-121
sp|Q10XM3|IF2_TRIEI Translation initiation factor IF-2 OS=Trichodesmium erythraeum (strain IMS101) GN=infB PE=3 SV=1 137 671 2.0E-121
sp|Q83BS1|IF2_COXBU Translation initiation factor IF-2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=infB PE=3 SV=1 7 671 2.0E-121
sp|A0RQZ4|IF2_CAMFF Translation initiation factor IF-2 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=infB PE=3 SV=1 143 671 3.0E-121
sp|A9N8V6|IF2_COXBR Translation initiation factor IF-2 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=infB PE=3 SV=1 7 671 3.0E-121
sp|A6L030|IF2_BACV8 Translation initiation factor IF-2 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=infB PE=3 SV=1 31 671 3.0E-121
sp|A7GZZ3|IF2_CAMC5 Translation initiation factor IF-2 OS=Campylobacter curvus (strain 525.92) GN=infB PE=3 SV=1 57 671 3.0E-121
sp|B8DG02|IF2_LISMH Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=infB PE=3 SV=1 62 668 3.0E-121
sp|A5D2S0|IF2_PELTS Translation initiation factor IF-2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=infB PE=3 SV=1 50 671 3.0E-121
sp|A9VT50|IF2_BACWK Translation initiation factor IF-2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=infB PE=3 SV=1 42 666 4.0E-121
sp|B8FCY5|IF2_DESAA Translation initiation factor IF-2 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=infB PE=3 SV=1 62 666 5.0E-121
sp|Q92C29|IF2_LISIN Translation initiation factor IF-2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=infB PE=3 SV=1 62 668 5.0E-121
sp|Q46J13|IF2_PROMT Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain NATL2A) GN=infB PE=3 SV=1 143 671 5.0E-121
sp|B2FN90|IF2_STRMK Translation initiation factor IF-2 OS=Stenotrophomonas maltophilia (strain K279a) GN=infB PE=3 SV=1 48 671 6.0E-121
sp|B4SQS0|IF2_STRM5 Translation initiation factor IF-2 OS=Stenotrophomonas maltophilia (strain R551-3) GN=infB PE=3 SV=1 48 671 8.0E-121
sp|B5YHT8|IF2_THEYD Translation initiation factor IF-2 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=infB PE=3 SV=1 62 662 8.0E-121
sp|A9HF18|IF2_GLUDA Translation initiation factor IF-2 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=infB PE=3 SV=1 62 663 9.0E-121
sp|Q1IF43|IF2_PSEE4 Translation initiation factor IF-2 OS=Pseudomonas entomophila (strain L48) GN=infB PE=3 SV=1 62 671 9.0E-121
sp|Q71ZZ7|IF2_LISMF Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=infB PE=3 SV=1 62 668 9.0E-121
sp|C1L2N1|IF2_LISMC Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=infB PE=3 SV=1 62 668 9.0E-121
sp|Q64ZR4|IF2_BACFR Translation initiation factor IF-2 OS=Bacteroides fragilis (strain YCH46) GN=infB PE=3 SV=1 31 671 1.0E-120
sp|Q5LIN1|IF2_BACFN Translation initiation factor IF-2 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=infB PE=3 SV=1 31 671 1.0E-120
sp|A2BYM0|IF2_PROM5 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9515) GN=infB PE=3 SV=1 137 671 1.0E-120
sp|Q5L0I8|IF2_GEOKA Translation initiation factor IF-2 OS=Geobacillus kaustophilus (strain HTA426) GN=infB PE=3 SV=1 55 631 1.0E-120
sp|Q8Y7F6|IF2_LISMO Translation initiation factor IF-2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=infB PE=3 SV=1 62 668 1.0E-120
sp|A5N842|IF2_CLOK5 Translation initiation factor IF-2 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=infB PE=3 SV=1 138 668 1.0E-120
sp|A7Z4T4|IF2_BACMF Translation initiation factor IF-2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=infB PE=3 SV=1 68 662 2.0E-120
sp|Q12AU7|IF2_POLSJ Translation initiation factor IF-2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=infB PE=3 SV=1 60 671 2.0E-120
sp|Q65JI1|IF2_BACLD Translation initiation factor IF-2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=infB PE=3 SV=1 40 662 3.0E-120
sp|B1J2A9|IF2_PSEPW Translation initiation factor IF-2 OS=Pseudomonas putida (strain W619) GN=infB PE=3 SV=1 62 671 3.0E-120
sp|A2C4P1|IF2_PROM1 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain NATL1A) GN=infB PE=3 SV=1 143 671 3.0E-120
sp|Q4L5X1|IF2_STAHJ Translation initiation factor IF-2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=infB PE=3 SV=1 52 669 3.0E-120
sp|Q7V5M4|IF2_PROMM Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9313) GN=infB PE=3 SV=1 143 671 4.0E-120
sp|Q8CST4|IF2_STAES Translation initiation factor IF-2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=infB PE=3 SV=1 59 669 4.0E-120
sp|Q5HPS2|IF2_STAEQ Translation initiation factor IF-2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=infB PE=3 SV=1 59 669 4.0E-120
sp|A0AIC6|IF2_LISW6 Translation initiation factor IF-2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=infB PE=3 SV=1 62 668 5.0E-120
sp|B1XI09|IF2_SYNP2 Translation initiation factor IF-2 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=infB PE=3 SV=1 140 671 5.0E-120
sp|Q38W81|IF2_LACSS Translation initiation factor IF-2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=infB PE=3 SV=1 10 665 6.0E-120
sp|A9BCI5|IF2_PROM4 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9211) GN=infB PE=3 SV=1 143 671 6.0E-120
sp|A7H1L5|IF2_CAMJD Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=infB PE=3 SV=1 140 671 6.0E-120
sp|Q2IPZ7|IF2_ANADE Translation initiation factor IF-2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=infB PE=3 SV=1 62 671 6.0E-120
sp|A8FJU1|IF2_CAMJ8 Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=infB PE=3 SV=1 140 671 7.0E-120
sp|Q89AF5|IF2_BUCBP Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=infB PE=3 SV=1 62 669 8.0E-120
sp|Q3AQK7|IF2_CHLCH Translation initiation factor IF-2 OS=Chlorobium chlorochromatii (strain CaD3) GN=infB PE=3 SV=1 18 671 8.0E-120
sp|Q3AB98|IF2_CARHZ Translation initiation factor IF-2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=infB PE=3 SV=1 59 671 9.0E-120
sp|Q5HX30|IF2_CAMJR Translation initiation factor IF-2 OS=Campylobacter jejuni (strain RM1221) GN=infB PE=3 SV=1 140 671 1.0E-119
sp|A2C6Q5|IF2_PROM3 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9303) GN=infB PE=3 SV=1 143 671 1.0E-119
sp|Q9PIZ1|IF2_CAMJE Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=infB PE=3 SV=1 140 671 1.0E-119
sp|Q8A2A1|IF2_BACTN Translation initiation factor IF-2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=infB PE=3 SV=1 33 671 2.0E-119
sp|Q9KA77|IF2_BACHD Translation initiation factor IF-2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=infB PE=3 SV=1 47 662 2.0E-119
sp|B0KHX8|IF2_PSEPG Translation initiation factor IF-2 OS=Pseudomonas putida (strain GB-1) GN=infB PE=3 SV=1 62 671 3.0E-119
sp|Q88DV7|IF2_PSEPK Translation initiation factor IF-2 OS=Pseudomonas putida (strain KT2440) GN=infB PE=3 SV=1 62 671 3.0E-119
sp|A0Q0Q7|IF2_CLONN Translation initiation factor IF-2 OS=Clostridium novyi (strain NT) GN=infB PE=3 SV=1 142 668 3.0E-119
sp|B3EFB1|IF2_CHLL2 Translation initiation factor IF-2 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=infB PE=3 SV=1 20 671 3.0E-119
sp|A4XL70|IF2_CALS8 Translation initiation factor IF-2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=infB PE=3 SV=1 64 663 3.0E-119
sp|A5W987|IF2_PSEP1 Translation initiation factor IF-2 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=infB PE=3 SV=1 62 671 3.0E-119
sp|A6VU29|IF2_MARMS Translation initiation factor IF-2 OS=Marinomonas sp. (strain MWYL1) GN=infB PE=3 SV=1 62 671 4.0E-119
sp|Q0AYI8|IF2_SYNWW Translation initiation factor IF-2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=infB PE=3 SV=1 3 662 5.0E-119
sp|Q1LSK8|IF2_BAUCH Translation initiation factor IF-2 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=infB PE=3 SV=1 62 663 5.0E-119
sp|C3L0B6|IF2_CLOB6 Translation initiation factor IF-2 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=infB PE=3 SV=1 140 668 5.0E-119
sp|A1VXL9|IF2_CAMJJ Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=infB PE=3 SV=1 140 671 7.0E-119
sp|A1VG83|IF2_DESVV Translation initiation factor IF-2 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=infB PE=3 SV=1 62 671 7.0E-119
sp|Q72ER1|IF2_DESVH Translation initiation factor IF-2 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=infB PE=3 SV=1 62 671 8.0E-119
sp|Q9PGR3|IF2_XYLFA Translation initiation factor IF-2 OS=Xylella fastidiosa (strain 9a5c) GN=infB PE=3 SV=1 62 671 8.0E-119
sp|A0LV27|IF2_ACIC1 Translation initiation factor IF-2 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=infB PE=3 SV=1 138 670 8.0E-119
sp|B0U1Q8|IF2_XYLFM Translation initiation factor IF-2 OS=Xylella fastidiosa (strain M12) GN=infB PE=3 SV=1 62 671 8.0E-119
sp|A5GNJ0|IF2_SYNPW Translation initiation factor IF-2 OS=Synechococcus sp. (strain WH7803) GN=infB PE=3 SV=1 143 671 8.0E-119
sp|P18311|IF2_ENTFC Translation initiation factor IF-2 OS=Enterococcus faecium GN=infB PE=3 SV=1 66 666 9.0E-119
sp|A8AVQ2|IF2_STRGC Translation initiation factor IF-2 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=infB PE=3 SV=1 68 667 9.0E-119
sp|B1II49|IF2_CLOBK Translation initiation factor IF-2 OS=Clostridium botulinum (strain Okra / Type B1) GN=infB PE=3 SV=1 140 668 9.0E-119
sp|B8I6E7|IF2_CLOCE Translation initiation factor IF-2 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=infB PE=3 SV=1 62 666 1.0E-118
sp|A2SH40|IF2_METPP Translation initiation factor IF-2 OS=Methylibium petroleiphilum (strain PM1) GN=infB PE=3 SV=1 62 671 2.0E-118
sp|Q7VQM3|IF2_BLOFL Translation initiation factor IF-2 OS=Blochmannia floridanus GN=infB PE=3 SV=1 32 665 2.0E-118
sp|B3EUG6|IF2_AMOA5 Translation initiation factor IF-2 OS=Amoebophilus asiaticus (strain 5a2) GN=infB PE=3 SV=1 19 671 2.0E-118
sp|Q18BH4|IF2_PEPD6 Translation initiation factor IF-2 OS=Peptoclostridium difficile (strain 630) GN=infB PE=3 SV=1 73 662 2.0E-118
sp|C1FS59|IF2_CLOBJ Translation initiation factor IF-2 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=infB PE=3 SV=1 140 668 2.0E-118
sp|Q1GVI9|IF2_SPHAL Translation initiation factor IF-2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=infB PE=3 SV=1 62 671 2.0E-118
sp|B2J955|IF2_NOSP7 Translation initiation factor IF-2 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=infB PE=3 SV=1 143 671 3.0E-118
sp|Q7VA20|IF2_PROMA Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=infB PE=3 SV=1 137 671 3.0E-118
sp|A4VPP0|IF2_PSEU5 Translation initiation factor IF-2 OS=Pseudomonas stutzeri (strain A1501) GN=infB PE=3 SV=1 29 671 3.0E-118
sp|Q0I7K2|IF2_SYNS3 Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9311) GN=infB PE=3 SV=1 143 671 3.0E-118
sp|A6GWV8|IF2_FLAPJ Translation initiation factor IF-2 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=infB PE=3 SV=1 31 671 4.0E-118
sp|C4Z5N7|IF2_EUBE2 Translation initiation factor IF-2 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=infB PE=3 SV=1 62 662 4.0E-118
sp|Q7UZZ9|IF2_PROMP Translation initiation factor IF-2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=infB PE=3 SV=1 137 671 5.0E-118
sp|B8HUA9|IF2_CYAP4 Translation initiation factor IF-2 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=infB PE=3 SV=1 97 671 5.0E-118
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 135 671 5.0E-118
sp|A5I4J3|IF2_CLOBH Translation initiation factor IF-2 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=infB PE=3 SV=1 140 668 5.0E-118
sp|A7FVZ3|IF2_CLOB1 Translation initiation factor IF-2 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=infB PE=3 SV=1 140 668 5.0E-118
sp|B1KWK7|IF2_CLOBM Translation initiation factor IF-2 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=infB PE=3 SV=1 140 668 6.0E-118
sp|B5EI57|IF2_GEOBB Translation initiation factor IF-2 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=infB PE=3 SV=1 62 663 6.0E-118
sp|C6E2Q0|IF2_GEOSM Translation initiation factor IF-2 OS=Geobacter sp. (strain M21) GN=infB PE=3 SV=1 62 663 6.0E-118
sp|A3PEY3|IF2_PROM0 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9301) GN=infB PE=3 SV=1 137 671 7.0E-118
sp|A0LXQ1|IF2_GRAFK Translation initiation factor IF-2 OS=Gramella forsetii (strain KT0803) GN=infB PE=3 SV=1 28 671 9.0E-118
sp|Q03M88|IF2_STRTD Translation initiation factor IF-2 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=infB PE=3 SV=1 59 666 9.0E-118
sp|Q5M1B9|IF2_STRT1 Translation initiation factor IF-2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=infB PE=3 SV=1 59 666 1.0E-117
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0032550 purine ribonucleoside binding No
GO:0001883 purine nucleoside binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0032549 ribonucleoside binding No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0032561 guanyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0001882 nucleoside binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8101
MGSEVKPKERSKKFHRGRRVGGYDDDWGDEALYRWEDRQRVKAQQQGSGQQAAKEDDAPIPIFVPEFISTGRLAQ
ALKQRPNHFLHDMEEMGFENVTLDTIMTGETAALVAMEYGYDPTVDNGSQRDLRPRPPPEVVSSLPERPPVVTIM
GHVDHGKTTLLDWLRKSSIAAQEHGGITQHIGAFVVKMSSGRPITFLDTPGHAAFLSMRQRGANVTDMVVLVVAA
DDSVMPQTIEAMKHATAAKVPIIVAINKIDKEDARVDQVKADLARHGVQIEDYGGDVQVACVSGKTGQGMDDLEE
NITTLSEVLDVRAETDGLAEGWVLESSVKQDGKVATILVKRGTLRPGDFIVAGKSWARVRVLRNEAGSELKEAPP
GTPVEVLGWRILPPAGELVLQAPNEDKARMAVEYRLEIANREESSVQLAEHEQRLRDKAAAEAAKAKAEAEDEAD
ADAMAEPKAAEPTMLYQNFIVKADVVGSAEAVCGSIMELGNNEVRPRVLRSSAGQVSEYDVDYAASSNGIIINFN
MAILPHIRQRAESAKVKILNHSVIYHVVDEAKAALSDLLPLKISHRVLGEADVLQIFSINIRKRIMKNIAGCRVR
NGTIKSTSRIKVLRKGDTIYDGLIDTLKHVKKDVAEMGKGNECGIGLDGFQALEVDDQIQTYEEVKEKRSL*
Coding >Hirsu2|8101
ATGGGGAGCGAAGTAAAGCCCAAAGAGAGGTCCAAGAAGTTCCACAGAGGGAGGCGGGTGGGGGGCTATGACGAC
GACTGGGGCGACGAGGCGCTTTATCGCTGGGAGGACCGACAGCGAGTCAAGGCGCAGCAACAAGGCAGTGGCCAG
CAAGCCGCGAAAGAGGACGATGCGCCGATCCCCATATTCGTTCCCGAGTTCATTAGCACGGGAAGGCTGGCACAA
GCGTTGAAACAACGCCCGAACCATTTCCTGCATGACATGGAGGAAATGGGCTTCGAGAACGTTACGCTCGACACA
ATCATGACGGGCGAGACGGCGGCACTTGTCGCCATGGAGTACGGTTATGACCCAACCGTGGACAACGGGTCGCAA
AGAGACCTGAGACCCCGGCCGCCGCCCGAGGTTGTCTCATCCCTTCCCGAGCGCCCCCCGGTGGTTACAATCATG
GGCCACGTCGATCACGGCAAGACGACGCTCCTCGACTGGCTGAGGAAGTCGTCCATTGCCGCGCAAGAGCATGGT
GGCATCACACAACATATCGGCGCCTTTGTGGTCAAAATGTCGTCTGGCAGGCCCATTACCTTCCTCGACACGCCT
GGGCACGCTGCCTTTTTGTCCATGCGGCAACGTGGAGCGAACGTGACCGACATGGTCGTGCTGGTGGTTGCAGCA
GACGACAGCGTCATGCCGCAGACGATAGAGGCCATGAAGCACGCCACGGCGGCCAAAGTGCCCATCATTGTGGCC
ATTAACAAGATCGACAAGGAAGACGCACGTGTTGATCAGGTCAAAGCGGACCTGGCGCGGCATGGCGTTCAGATT
GAGGACTACGGAGGCGACGTGCAGGTCGCCTGCGTCAGCGGCAAGACTGGCCAGGGTATGGACGACCTGGAGGAG
AATATCACTACGCTCTCCGAGGTTCTCGACGTGCGCGCTGAGACCGACGGCCTGGCCGAAGGCTGGGTCCTCGAG
TCGAGCGTCAAGCAAGATGGTAAGGTGGCTACGATCTTGGTCAAGCGAGGAACACTGCGGCCTGGCGACTTCATC
GTGGCCGGCAAGTCCTGGGCCAGAGTCCGCGTGCTCCGCAACGAGGCCGGCTCCGAACTAAAAGAAGCGCCCCCG
GGCACGCCCGTGGAGGTCCTTGGCTGGCGGATTCTGCCCCCCGCCGGAGAGCTGGTGCTGCAGGCCCCCAACGAG
GACAAGGCCAGAATGGCAGTCGAATACCGCCTGGAGATAGCCAACCGCGAAGAGAGCTCCGTGCAGCTCGCCGAG
CATGAGCAGCGCCTGCGGGACAAGGCGGCCGCAGAAGCCGCCAAAGCGAAAGCCGAAGCCGAAGACGAAGCCGAC
GCTGACGCCATGGCCGAGCCCAAGGCCGCTGAACCTACCATGCTATACCAAAACTTCATCGTCAAAGCGGACGTT
GTAGGCTCGGCCGAGGCAGTCTGCGGCAGCATCATGGAGCTGGGCAACAACGAGGTCCGACCCAGGGTCCTGCGA
TCTTCAGCAGGTCAGGTCTCCGAGTACGATGTCGACTACGCGGCGAGCTCGAACGGCATCATCATCAACTTCAAC
ATGGCGATCTTGCCGCACATCAGGCAGCGTGCCGAGTCAGCCAAGGTCAAGATCCTAAACCATAGCGTCATCTAC
CACGTCGTCGATGAGGCCAAGGCCGCGCTATCGGACCTTTTGCCATTGAAGATATCGCACCGCGTCCTTGGGGAG
GCGGACGTTCTGCAAATCTTCTCCATCAACATCAGGAAGCGAATAATGAAGAACATTGCAGGCTGCAGGGTGCGC
AATGGCACGATCAAGAGCACGTCTCGAATCAAGGTGCTGCGCAAGGGTGACACGATATATGACGGACTCATCGAC
ACACTGAAGCACGTTAAGAAGGACGTTGCGGAGATGGGCAAAGGCAACGAGTGCGGTATCGGTCTGGATGGTTTT
CAGGCCTTGGAGGTCGACGACCAGATCCAGACGTACGAAGAGGTCAAGGAGAAGCGCAGCCTGTAG
Transcript >Hirsu2|8101
ATGGGGAGCGAAGTAAAGCCCAAAGAGAGGTCCAAGAAGTTCCACAGAGGGAGGCGGGTGGGGGGCTATGACGAC
GACTGGGGCGACGAGGCGCTTTATCGCTGGGAGGACCGACAGCGAGTCAAGGCGCAGCAACAAGGCAGTGGCCAG
CAAGCCGCGAAAGAGGACGATGCGCCGATCCCCATATTCGTTCCCGAGTTCATTAGCACGGGAAGGCTGGCACAA
GCGTTGAAACAACGCCCGAACCATTTCCTGCATGACATGGAGGAAATGGGCTTCGAGAACGTTACGCTCGACACA
ATCATGACGGGCGAGACGGCGGCACTTGTCGCCATGGAGTACGGTTATGACCCAACCGTGGACAACGGGTCGCAA
AGAGACCTGAGACCCCGGCCGCCGCCCGAGGTTGTCTCATCCCTTCCCGAGCGCCCCCCGGTGGTTACAATCATG
GGCCACGTCGATCACGGCAAGACGACGCTCCTCGACTGGCTGAGGAAGTCGTCCATTGCCGCGCAAGAGCATGGT
GGCATCACACAACATATCGGCGCCTTTGTGGTCAAAATGTCGTCTGGCAGGCCCATTACCTTCCTCGACACGCCT
GGGCACGCTGCCTTTTTGTCCATGCGGCAACGTGGAGCGAACGTGACCGACATGGTCGTGCTGGTGGTTGCAGCA
GACGACAGCGTCATGCCGCAGACGATAGAGGCCATGAAGCACGCCACGGCGGCCAAAGTGCCCATCATTGTGGCC
ATTAACAAGATCGACAAGGAAGACGCACGTGTTGATCAGGTCAAAGCGGACCTGGCGCGGCATGGCGTTCAGATT
GAGGACTACGGAGGCGACGTGCAGGTCGCCTGCGTCAGCGGCAAGACTGGCCAGGGTATGGACGACCTGGAGGAG
AATATCACTACGCTCTCCGAGGTTCTCGACGTGCGCGCTGAGACCGACGGCCTGGCCGAAGGCTGGGTCCTCGAG
TCGAGCGTCAAGCAAGATGGTAAGGTGGCTACGATCTTGGTCAAGCGAGGAACACTGCGGCCTGGCGACTTCATC
GTGGCCGGCAAGTCCTGGGCCAGAGTCCGCGTGCTCCGCAACGAGGCCGGCTCCGAACTAAAAGAAGCGCCCCCG
GGCACGCCCGTGGAGGTCCTTGGCTGGCGGATTCTGCCCCCCGCCGGAGAGCTGGTGCTGCAGGCCCCCAACGAG
GACAAGGCCAGAATGGCAGTCGAATACCGCCTGGAGATAGCCAACCGCGAAGAGAGCTCCGTGCAGCTCGCCGAG
CATGAGCAGCGCCTGCGGGACAAGGCGGCCGCAGAAGCCGCCAAAGCGAAAGCCGAAGCCGAAGACGAAGCCGAC
GCTGACGCCATGGCCGAGCCCAAGGCCGCTGAACCTACCATGCTATACCAAAACTTCATCGTCAAAGCGGACGTT
GTAGGCTCGGCCGAGGCAGTCTGCGGCAGCATCATGGAGCTGGGCAACAACGAGGTCCGACCCAGGGTCCTGCGA
TCTTCAGCAGGTCAGGTCTCCGAGTACGATGTCGACTACGCGGCGAGCTCGAACGGCATCATCATCAACTTCAAC
ATGGCGATCTTGCCGCACATCAGGCAGCGTGCCGAGTCAGCCAAGGTCAAGATCCTAAACCATAGCGTCATCTAC
CACGTCGTCGATGAGGCCAAGGCCGCGCTATCGGACCTTTTGCCATTGAAGATATCGCACCGCGTCCTTGGGGAG
GCGGACGTTCTGCAAATCTTCTCCATCAACATCAGGAAGCGAATAATGAAGAACATTGCAGGCTGCAGGGTGCGC
AATGGCACGATCAAGAGCACGTCTCGAATCAAGGTGCTGCGCAAGGGTGACACGATATATGACGGACTCATCGAC
ACACTGAAGCACGTTAAGAAGGACGTTGCGGAGATGGGCAAAGGCAACGAGTGCGGTATCGGTCTGGATGGTTTT
CAGGCCTTGGAGGTCGACGACCAGATCCAGACGTACGAAGAGGTCAAGGAGAAGCGCAGCCTGTAG
Gene >Hirsu2|8101
ATGGGGAGCGAAGTAAAGCCCAAAGAGAGGTCCAAGAAGTTCCACAGAGGGAGGCGGGTGGGGGGCTATGACGAC
GACTGGGGCGACGAGGCGCTTTATCGCTGGGAGGACCGACAGCGAGTCAAGGCGCAGCAACAAGGCAGTGGCCAG
CAAGCCGCGAAAGAGGACGATGCGCCGATCCCCATATTCGTTCCCGAGTTCATTAGCACGGGAAGGCTGGCACAA
GCGTTGAAACAACGCCCGAACCATTTCCTGCATGACATGGAGGAAATGGGCTTCGAGAACGTTACGCTCGACACA
ATCATGACGGGCGAGACGGCGGCACTTGTCGCCATGGAGTACGGTTATGACCCAACCGTGGACAACGGGTCGCAA
AGAGACCTGAGACCCCGGCCGCCGCCCGAGGTTGTCTCATCCCTTCCCGAGCGCCCCCCGGTGGTTACAATCATG
GGCCACGTCGATCACGGCAAGACGACGCTCCTCGACTGGCTGAGGAAGTCGTCCATTGCCGCGCAAGAGCATGGT
GGCATCACACAACATATCGGCGCCTTTGTGGTCAAAATGTCGTCTGGCAGGCCCATTACCTTCCTCGACACGCCT
GGGCACGCTGCCTTTTTGTCCATGCGGCAACGTGGAGCGAACGTGACCGACATGGTCGTGCTGGTGGTTGCAGCA
GACGACAGCGTCATGCCGCAGACGATAGAGGCCATGAAGCACGCCACGGCGGCCAAAGTGCCCATCATTGTGGCC
ATTAACAAGATCGACAAGGAAGACGCACGTGTTGATCAGGTCAAAGCGGACCTGGCGCGGCATGGCGTTCAGATT
GAGGACTACGGAGGCGACGTGCAGGTCGCCTGCGTCAGCGGCAAGACTGGCCAGGGTATGGACGACCTGGAGGAG
AATATCACTACGCTCTCCGAGGTTCTCGACGTGCGCGCTGAGACCGACGGCCTGGCCGAAGGCTGGGTCCTCGAG
TCGAGCGTCAAGCAAGATGGTAAGGTGGCTACGATCTTGGTCAAGCGAGGAACACTGCGGCCTGGCGACTTCATC
GTGGCCGGCAAGTCCTGGGCCAGAGTCCGCGTGCTCCGCAACGAGGCCGGCTCCGAACTAAAAGAAGCGCCCCCG
GGCACGCCCGTGGAGGTCCTTGGCTGGCGGATTCTGCCCCCCGCCGGAGAGCTGGTGCTGCAGGCCCCCAACGAG
GACAAGGCCAGAATGGCAGTCGAATACCGCCTGGAGATAGCCAACCGCGAAGAGAGCTCCGTGCAGCTCGCCGAG
CATGAGCAGCGCCTGCGGGACAAGGCGGCCGCAGAAGCCGCCAAAGCGAAAGCCGAAGCCGAAGACGAAGCCGAC
GCTGACGCCATGGCCGAGCCCAAGGCCGCTGAACCTACCATGCTATACCAAAACTTCATCGTCAAAGCGGACGTT
GTAGGCTCGGCCGAGGCAGTCTGCGGCAGCATCATGGAGCTGGGCAACAACGAGGTCCGACCCAGGGTCCTGCGA
TCTTCAGCAGGTCAGGTCTCCGAGTACGATGTCGACTACGCGGCGAGCTCGAACGGCATCATCATCAACTTCAAC
ATGGCGATCTTGCCGCACATCAGGCAGCGTGCCGAGTCAGCCAAGGTCAAGATCCTAAACCATAGCGTCATCTAC
CACGTCGTCGATGAGGCCAAGGCCGCGCTATCGGACCTTTTGCCATTGAAGATATCGCACCGCGTCCTTGGGGAG
GCGGACGTTCTGCAAATCTTCTCCATCAACATCAGGAAGCGAATAATGAAGAACATTGCAGGCTGCAGGGTGCGC
AATGGCACGATCAAGAGCACGTCTCGAATCAAGGTGCTGCGCAAGGGTGACACGATATATGACGGTTCGTCGGCT
CATCTCCCTCCCAAAGCTGCCCCTTTGCCAATATTTCCTCTCCACTCTCTGTCCTTCAGACCCGTCTGCTGGGAT
GTCTTCCCCTCCCTTGCCTTACTGCCAAGTGGGCTCCTGTCGCGGGACCACGATACTAATGCAAAGGCTCGGCGC
TTACTGTAGGACTCATCGACACACTGAAGCACGTTAAGAAGGACGTTGCGGAGATGGGCAAAGGCAACGAGTGCG
GTATCGGTCTGGATGGTTTTCAGGCCTTGGAGGTCGACGACCAGATCCAGACGTACGAAGAGGTCAAGGAGAAGC
GCAGCCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail