Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8086
Gene name
LocationContig_506:9232..10627
Strand+
Gene length (bp)1395
Transcript length (bp)1287
Coding sequence length (bp)1287
Protein length (aa) 429

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 1.8E-34 67 229

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8J0P4|CRF1_ASPFU Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=2 19 279 8.0E-70
sp|D4B4J2|CRH12_ARTBC Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03382 PE=3 SV=2 5 285 6.0E-63
sp|D4ALQ5|CRH11_ARTBC Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05253 PE=1 SV=2 22 284 1.0E-62
sp|Q5AFA2|CRH11_CANAL Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH11 PE=1 SV=1 10 284 2.0E-47
sp|P53301|CRH1_YEAST Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRH1 PE=1 SV=1 27 279 2.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8J0P4|CRF1_ASPFU Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=2 19 279 8.0E-70
sp|D4B4J2|CRH12_ARTBC Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03382 PE=3 SV=2 5 285 6.0E-63
sp|D4ALQ5|CRH11_ARTBC Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05253 PE=1 SV=2 22 284 1.0E-62
sp|Q5AFA2|CRH11_CANAL Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH11 PE=1 SV=1 10 284 2.0E-47
sp|P53301|CRH1_YEAST Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRH1 PE=1 SV=1 27 279 2.0E-46
sp|Q5AK54|CRH12_CANAL Extracellular glycosidase CRH12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH12 PE=1 SV=1 26 253 9.0E-28
sp|Q05790|CRR1_YEAST Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRR1 PE=2 SV=1 57 255 5.0E-26
sp|Q4WI46|CRF2_ASPFU Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=1 27 286 6.0E-25
sp|Q75A41|CRR1_ASHGO Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CRR1 PE=3 SV=1 87 239 7.0E-25
sp|Q5AJC0|UTR2_CANAL Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTR2 PE=1 SV=1 89 258 3.0E-18
sp|P32623|CRH2_YEAST Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTR2 PE=1 SV=3 47 288 2.0E-17
sp|Q38911|XTH15_ARATH Xyloglucan endotransglucosylase/hydrolase protein 15 OS=Arabidopsis thaliana GN=XTH15 PE=1 SV=1 85 245 1.0E-07
sp|Q9FKL9|XTH12_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 12 OS=Arabidopsis thaliana GN=XTH12 PE=2 SV=1 85 251 1.0E-07
sp|Q9ZSU4|XTH14_ARATH Xyloglucan endotransglucosylase/hydrolase protein 14 OS=Arabidopsis thaliana GN=XTH14 PE=1 SV=1 85 247 2.0E-07
sp|Q9SV60|XTH2_ARATH Xyloglucan endotransglucosylase/hydrolase protein 2 OS=Arabidopsis thaliana GN=XTH2 PE=2 SV=1 93 245 4.0E-07
sp|Q9SV61|XTH1_ARATH Putative xyloglucan endotransglucosylase/hydrolase protein 1 OS=Arabidopsis thaliana GN=XTH1 PE=3 SV=2 93 236 5.0E-07
sp|Q9M0D1|XTH19_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 19 OS=Arabidopsis thaliana GN=XTH19 PE=2 SV=1 85 249 1.0E-06
sp|Q9FKL8|XTH13_ARATH Putative xyloglucan endotransglucosylase/hydrolase protein 13 OS=Arabidopsis thaliana GN=XTH13 PE=3 SV=1 85 251 2.0E-06
sp|Q8LF99|XTH6_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 6 OS=Arabidopsis thaliana GN=XTH6 PE=2 SV=2 92 249 2.0E-06
sp|Q38907|XTH25_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 25 OS=Arabidopsis thaliana GN=XTH25 PE=2 SV=2 85 247 3.0E-06
sp|Q38910|XTH23_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 23 OS=Arabidopsis thaliana GN=XTH23 PE=2 SV=1 92 245 3.0E-06
sp|Q8LG58|XTH16_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 16 OS=Arabidopsis thaliana GN=XTH16 PE=2 SV=2 85 245 5.0E-06
sp|Q38909|XTH28_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 28 OS=Arabidopsis thaliana GN=XTH28 PE=2 SV=1 98 249 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8086
MFSHAFSATAVALALSSLASAQTSTECNPLLKDCPADPALGTTVTCDFTTKGDCSAFKNAAGTDLAYSGKGAEFK
ITKEADSPTLHANKFIFFGRVDVELQASPGVGIVTSVVLQSHDLDEIDWEWLGGKDGEVQTNYFSKGSTVTYDRS
ITYPLSRVTTQTRTYSIEWTSQNITWAVIDGNGPRNVLRTLTYQDAKGGSTYPQTPMQVRVGSWVGGRQDGNKGT
IEWAGGVADFKNAPYSAYYKKITIVDYAGKDGPANGGVKEYRYSDKTGSMKSIEVVKGESVSDEKASEENGSKNA
KDTGSNSHNEDKTLIEANKSASATPTPTDSLGSDATPTPTDSLGSDATPAHSLSDVEPQTTVATTLSAGSNRTTF
PSASGGGASSPSGSRPDNTAVPAVPAAAPRFAAAAYVSVLLATVAAVVGQLLL*
Coding >Hirsu2|8086
ATGTTCTCCCACGCCTTCTCTGCCACTGCCGTGGCCCTCGCCCTGTCGTCCCTCGCCTCCGCCCAGACGTCGACA
GAATGCAATCCCTTACTAAAGGACTGCCCTGCCGACCCGGCCCTCGGCACCACGGTCACCTGTGACTTCACCACC
AAAGGCGACTGCAGCGCCTTCAAGAACGCCGCCGGCACCGACCTTGCCTACAGCGGCAAGGGGGCCGAGTTCAAG
ATCACCAAGGAAGCCGACTCGCCCACGCTACACGCCAACAAGTTCATCTTCTTCGGCCGCGTCGACGTCGAGCTC
CAGGCTTCCCCCGGCGTCGGCATCGTCACCAGCGTCGTCCTCCAGTCCCACGATCTCGACGAGATCGACTGGGAA
TGGCTCGGCGGCAAAGACGGCGAGGTCCAGACCAACTACTTCAGCAAGGGCAGCACCGTCACCTATGACCGCAGC
ATCACCTACCCCCTGTCCAGGGTCACCACCCAGACGCGAACCTACTCCATCGAGTGGACGTCGCAAAACATCACC
TGGGCCGTCATCGACGGCAACGGACCCCGGAACGTGCTCCGCACCCTGACCTACCAGGACGCCAAGGGCGGCAGC
ACCTATCCCCAGACCCCCATGCAGGTTAGGGTCGGCAGCTGGGTCGGCGGCCGCCAGGACGGCAACAAGGGCACC
ATCGAATGGGCGGGCGGCGTGGCCGACTTCAAGAACGCGCCCTACAGCGCCTACTACAAGAAAATCACCATTGTC
GACTACGCCGGCAAGGACGGGCCCGCCAACGGCGGCGTCAAGGAGTACCGCTACAGCGACAAGACGGGCTCCATG
AAGAGCATCGAGGTCGTCAAGGGCGAGAGCGTGAGCGACGAGAAGGCGAGCGAGGAGAATGGCTCCAAGAATGCC
AAGGACACGGGCAGCAACAGCCACAACGAGGACAAGACGCTCATCGAGGCCAACAAGTCGGCCTCTGCCACGCCC
ACGCCCACGGACAGCCTGGGCTCCGACGCCACGCCCACGCCCACGGACAGCCTCGGCTCCGACGCCACGCCCGCC
CACAGCCTCAGCGACGTCGAGCCCCAGACCACCGTCGCCACGACGCTCTCGGCTGGGTCCAACCGCACCACGTTC
CCGTCCGCCTCGGGCGGCGGTGCCTCGTCTCCCTCTGGCAGCAGGCCGGACAATACGGCGGTCCCCGCGGTCCCC
GCCGCCGCTCCTCGCTTCGCTGCCGCCGCCTACGTGTCGGTCCTCCTGGCCACCGTGGCCGCGGTTGTGGGCCAA
CTGCTACTCTAA
Transcript >Hirsu2|8086
ATGTTCTCCCACGCCTTCTCTGCCACTGCCGTGGCCCTCGCCCTGTCGTCCCTCGCCTCCGCCCAGACGTCGACA
GAATGCAATCCCTTACTAAAGGACTGCCCTGCCGACCCGGCCCTCGGCACCACGGTCACCTGTGACTTCACCACC
AAAGGCGACTGCAGCGCCTTCAAGAACGCCGCCGGCACCGACCTTGCCTACAGCGGCAAGGGGGCCGAGTTCAAG
ATCACCAAGGAAGCCGACTCGCCCACGCTACACGCCAACAAGTTCATCTTCTTCGGCCGCGTCGACGTCGAGCTC
CAGGCTTCCCCCGGCGTCGGCATCGTCACCAGCGTCGTCCTCCAGTCCCACGATCTCGACGAGATCGACTGGGAA
TGGCTCGGCGGCAAAGACGGCGAGGTCCAGACCAACTACTTCAGCAAGGGCAGCACCGTCACCTATGACCGCAGC
ATCACCTACCCCCTGTCCAGGGTCACCACCCAGACGCGAACCTACTCCATCGAGTGGACGTCGCAAAACATCACC
TGGGCCGTCATCGACGGCAACGGACCCCGGAACGTGCTCCGCACCCTGACCTACCAGGACGCCAAGGGCGGCAGC
ACCTATCCCCAGACCCCCATGCAGGTTAGGGTCGGCAGCTGGGTCGGCGGCCGCCAGGACGGCAACAAGGGCACC
ATCGAATGGGCGGGCGGCGTGGCCGACTTCAAGAACGCGCCCTACAGCGCCTACTACAAGAAAATCACCATTGTC
GACTACGCCGGCAAGGACGGGCCCGCCAACGGCGGCGTCAAGGAGTACCGCTACAGCGACAAGACGGGCTCCATG
AAGAGCATCGAGGTCGTCAAGGGCGAGAGCGTGAGCGACGAGAAGGCGAGCGAGGAGAATGGCTCCAAGAATGCC
AAGGACACGGGCAGCAACAGCCACAACGAGGACAAGACGCTCATCGAGGCCAACAAGTCGGCCTCTGCCACGCCC
ACGCCCACGGACAGCCTGGGCTCCGACGCCACGCCCACGCCCACGGACAGCCTCGGCTCCGACGCCACGCCCGCC
CACAGCCTCAGCGACGTCGAGCCCCAGACCACCGTCGCCACGACGCTCTCGGCTGGGTCCAACCGCACCACGTTC
CCGTCCGCCTCGGGCGGCGGTGCCTCGTCTCCCTCTGGCAGCAGGCCGGACAATACGGCGGTCCCCGCGGTCCCC
GCCGCCGCTCCTCGCTTCGCTGCCGCCGCCTACGTGTCGGTCCTCCTGGCCACCGTGGCCGCGGTTGTGGGCCAA
CTGCTACTCTAA
Gene >Hirsu2|8086
ATGTTCTCCCACGCCTTCTCTGCCACTGCCGTGGCCCTCGCCCTGTCGTCCCTCGCCTCCGCCCAGACGTCGACA
GAATGCAATCCCTTACTAAAGGGTCAGTAGTCCAGCCGCCTCCGAGCCCCCAAACCCGCTGCTGACGCGCGATGC
AGACTGCCCTGCCGACCCGGCCCTCGGCACCACGGTCACCTGTGACTTCACCACCAAAGGCGACTGCAGCGCCTT
CAAGAACGCCGCCGGCACCGACCTTGCCTACAGCGGCAAGGGGGCCGAGTTCAAGATCACCAAGGAAGCCGACTC
GCCCACGCTACACGCCAACAAGTTCATCTTCTTCGGCCGCGTCGACGTCGAGCTCCAGGCTTCCCCCGGCGTCGG
CATCGTCACCAGCGTCGTCCTCCAGTCCCACGATCTCGACGAGGTAGGCCCCTTTTCGCCTTGCCATCCCCTTCC
TCGCTAACCAACCCGTCGCAGATCGACTGGGAATGGCTCGGCGGCAAAGACGGCGAGGTCCAGACCAACTACTTC
AGCAAGGGCAGCACCGTCACCTATGACCGCAGCATCACCTACCCCCTGTCCAGGGTCACCACCCAGACGCGAACC
TACTCCATCGAGTGGACGTCGCAAAACATCACCTGGGCCGTCATCGACGGCAACGGACCCCGGAACGTGCTCCGC
ACCCTGACCTACCAGGACGCCAAGGGCGGCAGCACCTATCCCCAGACCCCCATGCAGGTTAGGGTCGGCAGCTGG
GTCGGCGGCCGCCAGGACGGCAACAAGGGCACCATCGAATGGGCGGGCGGCGTGGCCGACTTCAAGAACGCGCCC
TACAGCGCCTACTACAAGAAAATCACCATTGTCGACTACGCCGGCAAGGACGGGCCCGCCAACGGCGGCGTCAAG
GAGTACCGCTACAGCGACAAGACGGGCTCCATGAAGAGCATCGAGGTCGTCAAGGGCGAGAGCGTGAGCGACGAG
AAGGCGAGCGAGGAGAATGGCTCCAAGAATGCCAAGGACACGGGCAGCAACAGCCACAACGAGGACAAGACGCTC
ATCGAGGCCAACAAGTCGGCCTCTGCCACGCCCACGCCCACGGACAGCCTGGGCTCCGACGCCACGCCCACGCCC
ACGGACAGCCTCGGCTCCGACGCCACGCCCGCCCACAGCCTCAGCGACGTCGAGCCCCAGACCACCGTCGCCACG
ACGCTCTCGGCTGGGTCCAACCGCACCACGTTCCCGTCCGCCTCGGGCGGCGGTGCCTCGTCTCCCTCTGGCAGC
AGGCCGGACAATACGGCGGTCCCCGCGGTCCCCGCCGCCGCTCCTCGCTTCGCTGCCGCCGCCTACGTGTCGGTC
CTCCTGGCCACCGTGGCCGCGGTTGTGGGCCAACTGCTACTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail