Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8082
Gene name
LocationContig_506:2982..4415
Strand+
Gene length (bp)1433
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain 6.5E-36 241 386
PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain 1.6E-21 121 237

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99132|PRT1_PECCC Extracellular metalloprotease OS=Pectobacterium carotovorum subsp. carotovorum GN=prt1 PE=3 SV=1 61 386 3.0E-70
sp|A9YWT8|PRTS_PHOAZ Protease PrtS OS=Photorhabdus sp. (strain Az29) GN=prtS PE=1 SV=1 66 389 5.0E-66
sp|P68734|NPRE_BACPU Neutral protease NprE OS=Bacillus pumilus GN=nprE PE=1 SV=1 135 386 4.0E-39
sp|P06832|NPRE_BACAM Bacillolysin OS=Bacillus amyloliquefaciens GN=npr PE=1 SV=1 162 386 6.0E-39
sp|P68736|NPRE_BACSU Bacillolysin OS=Bacillus subtilis (strain 168) GN=nprE PE=1 SV=1 135 386 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99132|PRT1_PECCC Extracellular metalloprotease OS=Pectobacterium carotovorum subsp. carotovorum GN=prt1 PE=3 SV=1 61 386 3.0E-70
sp|A9YWT8|PRTS_PHOAZ Protease PrtS OS=Photorhabdus sp. (strain Az29) GN=prtS PE=1 SV=1 66 389 5.0E-66
sp|P68734|NPRE_BACPU Neutral protease NprE OS=Bacillus pumilus GN=nprE PE=1 SV=1 135 386 4.0E-39
sp|P06832|NPRE_BACAM Bacillolysin OS=Bacillus amyloliquefaciens GN=npr PE=1 SV=1 162 386 6.0E-39
sp|P68736|NPRE_BACSU Bacillolysin OS=Bacillus subtilis (strain 168) GN=nprE PE=1 SV=1 135 386 1.0E-38
sp|P68735|NPRE_BACSA Bacillolysin OS=Bacillus subtilis subsp. amylosacchariticus GN=nprE PE=1 SV=1 135 386 1.0E-38
sp|P06874|NPRT_GEOSE Thermostable neutral protease NprT OS=Geobacillus stearothermophilus GN=nprT PE=1 SV=1 164 386 8.0E-37
sp|Q59223|THER_BACSO Thermolysin OS=Bacillus sp. (strain EA1) GN=npr PE=1 SV=1 164 386 2.0E-36
sp|Q43880|THER_ALIAC Thermolysin OS=Alicyclobacillus acidocaldarius PE=1 SV=1 164 386 2.0E-36
sp|Q59193|THER_BACCL Thermolysin OS=Bacillus caldolyticus GN=npr PE=1 SV=1 164 386 2.0E-36
sp|P23384|NPRE_BACCL Bacillolysin OS=Bacillus caldolyticus GN=npr PE=1 SV=1 164 386 3.0E-36
sp|P00800|THER_BACTH Thermolysin OS=Bacillus thermoproteolyticus GN=npr PE=1 SV=3 164 386 5.0E-36
sp|P43133|THER_GEOSE Thermolysin OS=Geobacillus stearothermophilus GN=nprS PE=1 SV=1 164 386 6.0E-36
sp|P81177|AURE_STAAU Zinc metalloproteinase aureolysin OS=Staphylococcus aureus GN=aur PE=1 SV=2 142 386 3.0E-34
sp|D5DEH5|NPRM_BACMD Bacillolysin OS=Bacillus megaterium (strain DSM 319) GN=nprM PE=3 SV=1 126 386 7.0E-34
sp|P05806|NPRE_BACCE Bacillolysin OS=Bacillus cereus GN=npr PE=1 SV=2 164 386 1.0E-33
sp|P0CH29|NPRM_BACME Bacillolysin OS=Bacillus megaterium GN=nprM PE=1 SV=1 126 386 5.0E-33
sp|P39899|NPRB_BACSU Neutral protease B OS=Bacillus subtilis (strain 168) GN=nprB PE=1 SV=1 13 386 1.0E-32
sp|P34025|PRTA_LISMN Zinc metalloproteinase OS=Listeria monocytogenes GN=mpl PE=2 SV=3 166 387 8.0E-31
sp|P43263|NPRE_BREBE Bacillolysin OS=Brevibacillus brevis GN=npr PE=1 SV=1 165 386 2.0E-30
sp|P23224|PRTA_LISMO Zinc metalloproteinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mpl PE=2 SV=1 166 387 2.0E-30
sp|Q06517|SMP_SERME Extracellular minor metalloprotease OS=Serratia marcescens (strain ATCC 21074 / E-15) GN=smp PE=1 SV=1 58 349 2.0E-29
sp|P0C0Q3|SEPA_STAEP Extracellular elastase OS=Staphylococcus epidermidis GN=sepA PE=1 SV=1 168 386 5.0E-29
sp|P0C0Q4|SEPA_STAES Extracellular elastase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=sepA PE=3 SV=1 168 386 2.0E-28
sp|P29148|NPRE_PAEPO Bacillolysin OS=Paenibacillus polymyxa GN=npr PE=1 SV=1 165 344 1.0E-26
sp|Q833V7|GELE_ENTFA Gelatinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=gelE PE=1 SV=1 166 389 3.0E-24
sp|P83543|TAMP_STRMB Transglutaminase-activating metalloprotease OS=Streptomyces mobaraensis PE=1 SV=2 168 386 6.0E-16
sp|Q02RJ6|ELAS_PSEAB Elastase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lasB PE=1 SV=1 164 387 2.0E-15
sp|P24153|HAPT_VIBCH Hemagglutinin/proteinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hap PE=1 SV=1 166 340 5.0E-15
sp|P14756|ELAS_PSEAE Elastase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lasB PE=1 SV=1 164 387 7.0E-15
sp|Q00971|NPRV_VIBPR Neutral protease OS=Vibrio proteolyticus GN=nprV PE=1 SV=1 166 340 2.0E-14
sp|P55111|PRZN_RENSA Zinc metalloproteinase OS=Renibacterium salmoninarum GN=hly PE=1 SV=2 144 340 6.0E-14
sp|P43147|EMPA_VIBAN Virulence metalloprotease OS=Vibrio anguillarum GN=empA PE=1 SV=1 166 324 3.0E-13
sp|P21347|PROA_LEGPN Zinc metalloproteinase OS=Legionella pneumophila PE=1 SV=1 186 325 5.0E-13
sp|P55110|MSPA_LEGLO Zinc metalloproteinase MspA OS=Legionella longbeachae GN=mspA PE=3 SV=1 179 325 5.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0004222 metalloendopeptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0008237 metallopeptidase activity No
GO:0003674 molecular_function No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0008233 peptidase activity No
GO:0004175 endopeptidase activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8082
MPCHCSIVPPHLLRDIAESPSNPEHVRQAAHASLIAYESVSASRREFMAAEPGARGVRVRQPSSPFIPIGVLTRL
SVSDAVDEATRDQAKRDLEHLQMLAVEQASVTAADEDLEKGRHKNRPYRAVYDAKKSRDKAKLPGELIRAEGEAK
VKDEDVNLVYDNIGRVLDFYKKHFKWKSIDNKNGDVISSVHYGECFQNAYWTPDLKQLVFGDGSDLIGNFTGCVD
VIGHELTHAVTEWTSPLAYMDQSGALNEHIADVFGIMTKQVIENETADEADWLVGEDCLMPGGKDHQVDHMSKYF
TMYEDYGGVHIFSGIPNKAFYLAATAFGGYSWDKAGQIWWKTVTCGRVPFRCNFLQFADVTVDCAEEEFGEEAAQ
TVRKAWNDVGVTRKV*
Coding >Hirsu2|8082
ATGCCTTGCCACTGCTCCATCGTGCCGCCTCACCTTCTGCGCGACATCGCTGAGTCACCGAGCAACCCCGAGCAT
GTTCGCCAGGCGGCACACGCATCCCTCATCGCCTATGAGAGCGTTTCTGCGTCTCGCCGGGAGTTCATGGCGGCA
GAGCCCGGTGCTCGCGGCGTCCGTGTGCGCCAGCCTTCCTCGCCTTTCATCCCCATCGGCGTACTCACCCGTCTG
TCCGTCTCGGACGCCGTAGACGAGGCGACTCGCGACCAGGCCAAAAGAGATCTGGAACACCTCCAGATGCTTGCG
GTCGAGCAAGCGTCCGTGACCGCCGCAGACGAGGATCTTGAGAAGGGTCGACACAAGAACCGCCCATACCGAGCC
GTGTACGATGCCAAGAAATCGCGGGATAAAGCCAAGCTGCCCGGCGAGCTGATCCGAGCCGAAGGCGAGGCCAAG
GTCAAAGATGAGGACGTCAACCTTGTCTATGACAACATTGGGCGTGTCCTCGACTTCTATAAGAAGCATTTCAAA
TGGAAGTCGATCGACAACAAGAACGGCGACGTCATCAGCTCCGTTCACTACGGCGAATGTTTCCAGAATGCGTAC
TGGACTCCCGACTTGAAGCAGCTGGTCTTTGGTGATGGTAGCGACCTCATCGGCAACTTCACCGGCTGTGTCGAC
GTCATTGGACATGAACTGACACATGCCGTCACGGAGTGGACCAGCCCTCTCGCATATATGGACCAGTCTGGCGCC
CTTAACGAGCACATTGCCGACGTTTTCGGAATCATGACCAAGCAAGTGATCGAGAACGAAACGGCCGACGAGGCC
GACTGGCTCGTTGGCGAGGATTGTCTCATGCCAGGCGGCAAAGATCACCAGGTGGACCACATGTCCAAGTACTTC
ACGATGTACGAAGATTACGGGGGGGTTCACATCTTTTCGGGCATTCCCAACAAGGCCTTCTACCTGGCAGCCACG
GCGTTTGGCGGCTACTCGTGGGACAAGGCCGGCCAGATCTGGTGGAAGACGGTGACTTGCGGCCGCGTGCCCTTC
AGATGCAACTTCTTGCAGTTCGCCGACGTCACGGTCGACTGCGCCGAGGAGGAATTCGGCGAGGAGGCAGCCCAG
ACGGTGCGCAAGGCATGGAACGACGTTGGCGTGACGCGGAAGGTCTAG
Transcript >Hirsu2|8082
ATGCCTTGCCACTGCTCCATCGTGCCGCCTCACCTTCTGCGCGACATCGCTGAGTCACCGAGCAACCCCGAGCAT
GTTCGCCAGGCGGCACACGCATCCCTCATCGCCTATGAGAGCGTTTCTGCGTCTCGCCGGGAGTTCATGGCGGCA
GAGCCCGGTGCTCGCGGCGTCCGTGTGCGCCAGCCTTCCTCGCCTTTCATCCCCATCGGCGTACTCACCCGTCTG
TCCGTCTCGGACGCCGTAGACGAGGCGACTCGCGACCAGGCCAAAAGAGATCTGGAACACCTCCAGATGCTTGCG
GTCGAGCAAGCGTCCGTGACCGCCGCAGACGAGGATCTTGAGAAGGGTCGACACAAGAACCGCCCATACCGAGCC
GTGTACGATGCCAAGAAATCGCGGGATAAAGCCAAGCTGCCCGGCGAGCTGATCCGAGCCGAAGGCGAGGCCAAG
GTCAAAGATGAGGACGTCAACCTTGTCTATGACAACATTGGGCGTGTCCTCGACTTCTATAAGAAGCATTTCAAA
TGGAAGTCGATCGACAACAAGAACGGCGACGTCATCAGCTCCGTTCACTACGGCGAATGTTTCCAGAATGCGTAC
TGGACTCCCGACTTGAAGCAGCTGGTCTTTGGTGATGGTAGCGACCTCATCGGCAACTTCACCGGCTGTGTCGAC
GTCATTGGACATGAACTGACACATGCCGTCACGGAGTGGACCAGCCCTCTCGCATATATGGACCAGTCTGGCGCC
CTTAACGAGCACATTGCCGACGTTTTCGGAATCATGACCAAGCAAGTGATCGAGAACGAAACGGCCGACGAGGCC
GACTGGCTCGTTGGCGAGGATTGTCTCATGCCAGGCGGCAAAGATCACCAGGTGGACCACATGTCCAAGTACTTC
ACGATGTACGAAGATTACGGGGGGGTTCACATCTTTTCGGGCATTCCCAACAAGGCCTTCTACCTGGCAGCCACG
GCGTTTGGCGGCTACTCGTGGGACAAGGCCGGCCAGATCTGGTGGAAGACGGTGACTTGCGGCCGCGTGCCCTTC
AGATGCAACTTCTTGCAGTTCGCCGACGTCACGGTCGACTGCGCCGAGGAGGAATTCGGCGAGGAGGCAGCCCAG
ACGGTGCGCAAGGCATGGAACGACGTTGGCGTGACGCGGAAGGTCTAG
Gene >Hirsu2|8082
ATGCCTTGCCACTGCTCCATCGTGCCGCCTCACCTTCTGCGCGACATCGCTGAGTCACCGAGCAACCCCGAGCAT
GTTCGCCAGGCGGCACACGCATCCCTCATCGCCTATGAGAGCGTTTCTGCGTCTCGCCGGGAGTTCATGGCGGCA
GAGCCCGGTGCTCGCGGCGTCCGTGTGCGCCAGCCTTCCTCGCCTTTCATCCCCATCGGCGTACTCACCCGTCTG
TCCGTCTCGGACGCCGTAGACGAGGCGACTCGCGACCAGGCCAAAAGAGATCTGGAACACCTCCAGATGCTTGCG
GTCGAGCAAGGTATGCCACTGCACGCCCACAGCCGCTCTCACCGCCACCTGCCTTGCTAAGTTGGACACTGACGA
CCTTTTGTAGCGTCCGTGACCGCCGCAGACGAGGATCTTGAGAAGGGTCGACACAAGAACCGCCCATACCGAGCC
GTGTACGATGCCAAGAAATCGCGGGATAAAGCCAAGCTGCCCGGCGAGCTGATCCGAGCCGAAGGCGAGGCCAAG
GTCAAAGATGAGGACGTCAACCTTGTCTATGACAACATTGGGCGTGTCCTCGACTTCTATAAGAAGCATTTCAAA
TGGAAGTCGATCGACAACAAGAACGGCGACGTCATCAGCTCCGTTCACTACGGCGAATGTTTCCAGAATGCGTGT
TAGTGCTTTGACTTGCTGGACGGGGAGACAAGAGGACGCGACTGACTTGACGTCTGCTAGACTGGACTCCCGACT
TGAAGCAGCTGGTCTTTGGTGATGGTAGCGACCTCATCGGCAACTTCACCGGCTGTGTCGACGTCATTGGACATG
AACTGACACATGCCGTCACGGAGTGGACCAGCCCTCTCGCATATATGGACCAGTCTGGCGCCCTTAACGAGCACA
TTGCCGACGTTTTCGGAATCATGACCAAGCAAGTGATCGAGAACGAAACGGCCGACGAGGCCGACTGGCTCGTTG
GCGAGGATTGTCTCATGCCAGGCGTCAAGGGAATCGCTCTACGAAGCCTGAAGAAACCCGGCATGGCCTACGACG
ACCCTTAACTTGTAAGTCCTGCGCGGCTTGAGACGTGTTCGTCGACCTCGGCTGATTGCCCACGTGCGTAGGGCA
AAGATCACCAGGTGGACCACATGTCCAAGTACTTCACGATGTACGAAGATTACGGGGGGGTTCACATCTTTTCGG
GCATTCCCAACAAGGCCTTCTACCTGGCAGCCACGGCGTTTGGCGGCTACTCGTGGGACAAGGCCGGCCAGATCT
GGTGGAAGACGGTGACTTGCGGCCGCGTGCCCTTCAGATGCAACTTCTTGCAGTTCGCCGACGTCACGGTCGACT
GCGCCGAGGAGGAATTCGGCGAGGAGGCAGCCCAGACGGTGCGCAAGGCATGGAACGACGTTGGCGTGACGCGGA
AGGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail