Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8062
Gene name
LocationContig_503:411..1011
Strand+
Gene length (bp)600
Transcript length (bp)600
Coding sequence length (bp)600
Protein length (aa) 200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05180 zf-DNL DNL zinc finger 1.7E-25 86 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09759|YA72_SCHPO Uncharacterized protein C24H6.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.02c PE=3 SV=1 55 165 3.0E-24
sp|P42844|ZIM17_YEAST Mitochondrial protein import protein ZIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZIM17 PE=1 SV=2 86 185 3.0E-20
sp|A6ZSH0|ZIM17_YEAS7 Mitochondrial protein import protein ZIM17 OS=Saccharomyces cerevisiae (strain YJM789) GN=ZIM17 PE=3 SV=2 86 185 3.0E-20
sp|B5VQB0|ZIM17_YEAS6 Mitochondrial protein import protein ZIM17 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=ZIM17 PE=3 SV=2 86 185 3.0E-20
sp|B3LPE4|ZIM17_YEAS1 Mitochondrial protein import protein ZIM17 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ZIM17 PE=3 SV=2 86 185 3.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09759|YA72_SCHPO Uncharacterized protein C24H6.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.02c PE=3 SV=1 55 165 3.0E-24
sp|P42844|ZIM17_YEAST Mitochondrial protein import protein ZIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZIM17 PE=1 SV=2 86 185 3.0E-20
sp|A6ZSH0|ZIM17_YEAS7 Mitochondrial protein import protein ZIM17 OS=Saccharomyces cerevisiae (strain YJM789) GN=ZIM17 PE=3 SV=2 86 185 3.0E-20
sp|B5VQB0|ZIM17_YEAS6 Mitochondrial protein import protein ZIM17 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=ZIM17 PE=3 SV=2 86 185 3.0E-20
sp|B3LPE4|ZIM17_YEAS1 Mitochondrial protein import protein ZIM17 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ZIM17 PE=3 SV=2 86 185 3.0E-20
sp|Q5SXM8|DNLZ_HUMAN DNL-type zinc finger protein OS=Homo sapiens GN=DNLZ PE=1 SV=1 73 163 3.0E-16
sp|Q9D113|DNLZ_MOUSE DNL-type zinc finger protein OS=Mus musculus GN=Dnlz PE=1 SV=1 81 170 2.0E-15
sp|A1L1P7|DNLZ_DANRE DNL-type zinc finger protein OS=Danio rerio GN=dnlz PE=2 SV=1 51 152 3.0E-13
sp|Q0IH40|DNLZ_XENLA DNL-type zinc finger protein OS=Xenopus laevis GN=dnlz PE=2 SV=1 82 158 1.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8062
MASRSASLFPGLARAARSLYPRAPAVKQRSPFRAFATSRVRAAHDIPRPRPSPSARPDARESSGRGPDGAESEGP
RPAPKDAAYYQISFTCVPCSFRSHHNISKQGYHFGSILISCPECRNRHVISDHLNIFGDRKITVEDLMRERGRLV
KRGSLGEDGNIEFWPDLPPDEQPVVSESSSGEPEQKGDTAERRADERRE*
Coding >Hirsu2|8062
ATGGCATCCAGGTCGGCCTCGCTTTTCCCCGGCCTGGCCCGCGCCGCCCGCTCGCTCTATCCCCGAGCACCGGCA
GTCAAGCAGAGGTCACCTTTCAGAGCGTTTGCGACCTCTCGGGTCCGCGCCGCCCACGACATCCCGCGCCCTCGT
CCGTCTCCCTCTGCCCGGCCGGACGCCCGAGAAAGTAGCGGGCGGGGCCCGGACGGGGCCGAGTCAGAAGGCCCG
CGCCCCGCGCCCAAGGATGCCGCCTACTACCAAATCTCCTTCACCTGCGTTCCCTGCAGCTTCCGCTCCCACCAC
AACATCTCCAAGCAGGGCTACCACTTCGGATCCATCCTCATCTCGTGCCCCGAGTGCCGGAACCGACACGTGATC
AGTGACCACCTTAACATCTTTGGCGACCGCAAGATCACCGTCGAGGACCTGATGCGGGAAAGGGGCCGCCTCGTC
AAGAGGGGCAGCCTGGGCGAGGACGGCAACATCGAGTTCTGGCCCGACCTGCCTCCGGACGAGCAGCCGGTCGTA
TCCGAGTCATCATCAGGCGAACCGGAGCAGAAGGGAGACACGGCTGAGCGGCGGGCCGACGAACGTAGGGAATAA
Transcript >Hirsu2|8062
ATGGCATCCAGGTCGGCCTCGCTTTTCCCCGGCCTGGCCCGCGCCGCCCGCTCGCTCTATCCCCGAGCACCGGCA
GTCAAGCAGAGGTCACCTTTCAGAGCGTTTGCGACCTCTCGGGTCCGCGCCGCCCACGACATCCCGCGCCCTCGT
CCGTCTCCCTCTGCCCGGCCGGACGCCCGAGAAAGTAGCGGGCGGGGCCCGGACGGGGCCGAGTCAGAAGGCCCG
CGCCCCGCGCCCAAGGATGCCGCCTACTACCAAATCTCCTTCACCTGCGTTCCCTGCAGCTTCCGCTCCCACCAC
AACATCTCCAAGCAGGGCTACCACTTCGGATCCATCCTCATCTCGTGCCCCGAGTGCCGGAACCGACACGTGATC
AGTGACCACCTTAACATCTTTGGCGACCGCAAGATCACCGTCGAGGACCTGATGCGGGAAAGGGGCCGCCTCGTC
AAGAGGGGCAGCCTGGGCGAGGACGGCAACATCGAGTTCTGGCCCGACCTGCCTCCGGACGAGCAGCCGGTCGTA
TCCGAGTCATCATCAGGCGAACCGGAGCAGAAGGGAGACACGGCTGAGCGGCGGGCCGACGAACGTAGGGAATAA
Gene >Hirsu2|8062
ATGGCATCCAGGTCGGCCTCGCTTTTCCCCGGCCTGGCCCGCGCCGCCCGCTCGCTCTATCCCCGAGCACCGGCA
GTCAAGCAGAGGTCACCTTTCAGAGCGTTTGCGACCTCTCGGGTCCGCGCCGCCCACGACATCCCGCGCCCTCGT
CCGTCTCCCTCTGCCCGGCCGGACGCCCGAGAAAGTAGCGGGCGGGGCCCGGACGGGGCCGAGTCAGAAGGCCCG
CGCCCCGCGCCCAAGGATGCCGCCTACTACCAAATCTCCTTCACCTGCGTTCCCTGCAGCTTCCGCTCCCACCAC
AACATCTCCAAGCAGGGCTACCACTTCGGATCCATCCTCATCTCGTGCCCCGAGTGCCGGAACCGACACGTGATC
AGTGACCACCTTAACATCTTTGGCGACCGCAAGATCACCGTCGAGGACCTGATGCGGGAAAGGGGCCGCCTCGTC
AAGAGGGGCAGCCTGGGCGAGGACGGCAACATCGAGTTCTGGCCCGACCTGCCTCCGGACGAGCAGCCGGTCGTA
TCCGAGTCATCATCAGGCGAACCGGAGCAGAAGGGAGACACGGCTGAGCGGCGGGCCGACGAACGTAGGGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail