Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8061
Gene name
LocationContig_502:9639..14355
Strand-
Gene length (bp)4716
Transcript length (bp)4422
Coding sequence length (bp)4422
Protein length (aa) 1474

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 4.7E-56 56 406
PF00550 PP-binding Phosphopantetheine attachment site 2.1E-12 662 727

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 61 495 3.0E-49
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 31 495 1.0E-47
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 163 495 2.0E-44
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 169 505 1.0E-36
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 160 506 2.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 61 495 3.0E-49
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 31 495 1.0E-47
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 163 495 2.0E-44
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 169 505 1.0E-36
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 160 506 2.0E-27
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 164 508 2.0E-26
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 164 506 7.0E-26
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 164 506 8.0E-26
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 164 506 8.0E-26
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 164 506 9.0E-26
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 164 506 9.0E-26
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 164 505 1.0E-25
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 164 506 1.0E-25
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 164 506 1.0E-25
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 164 506 1.0E-25
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 164 506 1.0E-25
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 156 505 2.0E-25
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 164 506 2.0E-25
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 164 506 2.0E-25
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 164 506 1.0E-24
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 164 506 1.0E-24
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 164 517 2.0E-24
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 92 516 5.0E-24
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 61 506 6.0E-24
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 160 506 7.0E-24
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 127 507 1.0E-23
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 160 506 3.0E-23
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 164 508 5.0E-23
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 91 508 1.0E-22
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 91 508 2.0E-22
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 160 506 6.0E-22
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 160 506 8.0E-22
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 160 506 9.0E-22
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 160 506 1.0E-21
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 160 506 1.0E-21
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 160 506 1.0E-21
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 61 506 2.0E-21
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 160 506 2.0E-21
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 160 506 2.0E-21
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 160 506 2.0E-21
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 160 506 2.0E-21
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 160 506 3.0E-21
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 160 506 3.0E-21
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 164 506 3.0E-21
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 162 509 4.0E-21
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 160 506 4.0E-21
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 160 506 4.0E-21
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 160 506 4.0E-21
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 160 506 7.0E-21
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 160 506 7.0E-21
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 61 506 8.0E-21
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 160 506 9.0E-21
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 160 506 9.0E-21
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 160 506 9.0E-21
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 164 502 2.0E-20
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 88 509 3.0E-20
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 160 506 4.0E-20
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 162 506 5.0E-20
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 164 422 7.0E-20
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 88 510 9.0E-20
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 164 421 1.0E-19
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 136 507 2.0E-19
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 160 515 2.0E-19
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 60 510 3.0E-19
sp|P33124|ACSL6_RAT Long-chain-fatty-acid--CoA ligase 6 OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 158 433 3.0E-19
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 60 509 1.0E-18
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 164 420 1.0E-18
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 57 494 1.0E-18
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 160 506 1.0E-18
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 161 515 1.0E-18
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 61 422 1.0E-18
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 62 422 2.0E-18
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 61 494 2.0E-18
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 133 496 2.0E-18
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 60 513 2.0E-18
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 88 444 3.0E-18
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 156 418 4.0E-18
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 61 502 4.0E-18
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 61 418 5.0E-18
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 154 502 8.0E-18
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 165 440 8.0E-18
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 61 428 8.0E-18
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 164 417 8.0E-18
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 164 417 8.0E-18
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 25 417 9.0E-18
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 164 417 9.0E-18
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 61 418 9.0E-18
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 61 418 1.0E-17
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 124 501 1.0E-17
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 61 494 1.0E-17
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 164 417 1.0E-17
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 164 417 1.0E-17
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 164 417 1.0E-17
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 164 417 1.0E-17
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 164 417 1.0E-17
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 61 418 1.0E-17
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 61 418 1.0E-17
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 61 418 1.0E-17
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 61 418 1.0E-17
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 61 418 1.0E-17
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 61 418 1.0E-17
sp|Q9SS01|AAE20_ARATH Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 161 505 1.0E-17
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 165 440 1.0E-17
sp|P41216|ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 140 443 1.0E-17
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 124 501 1.0E-17
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 164 417 2.0E-17
sp|Q9JID6|ACSL1_CAVPO Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1 55 443 2.0E-17
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 124 501 2.0E-17
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 163 422 2.0E-17
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 61 494 2.0E-17
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 61 494 2.0E-17
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 158 417 2.0E-17
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 61 418 3.0E-17
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 61 418 3.0E-17
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 124 501 3.0E-17
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 124 501 4.0E-17
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 61 424 4.0E-17
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 60 510 4.0E-17
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 169 495 4.0E-17
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 60 422 4.0E-17
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 58 510 4.0E-17
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 124 501 4.0E-17
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 124 507 5.0E-17
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 124 501 5.0E-17
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 61 418 5.0E-17
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 157 502 5.0E-17
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 124 501 5.0E-17
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 161 519 6.0E-17
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 169 495 6.0E-17
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 61 418 6.0E-17
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 61 418 6.0E-17
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 168 510 7.0E-17
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 61 418 7.0E-17
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 61 418 7.0E-17
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 61 418 7.0E-17
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 154 502 7.0E-17
sp|Q91WC3|ACSL6_MOUSE Long-chain-fatty-acid--CoA ligase 6 OS=Mus musculus GN=Acsl6 PE=1 SV=1 140 493 8.0E-17
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 61 418 8.0E-17
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 61 418 8.0E-17
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 61 418 8.0E-17
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 61 418 8.0E-17
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 61 418 8.0E-17
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 61 418 9.0E-17
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 61 418 9.0E-17
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 61 418 9.0E-17
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 61 418 9.0E-17
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 61 418 9.0E-17
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 154 502 9.0E-17
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 154 502 9.0E-17
sp|Q9CHK3|MENE_LACLA 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 160 502 1.0E-16
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 61 418 1.0E-16
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 61 418 1.0E-16
sp|Q5HNB2|MENE_STAEQ 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 164 417 1.0E-16
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 124 501 1.0E-16
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 124 501 1.0E-16
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 124 501 1.0E-16
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 169 508 1.0E-16
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 49 494 1.0E-16
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 49 494 1.0E-16
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 49 494 1.0E-16
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 49 494 1.0E-16
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 49 428 1.0E-16
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 49 428 1.0E-16
sp|Q9ULC5|ACSL5_HUMAN Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens GN=ACSL5 PE=1 SV=1 156 456 1.0E-16
sp|Q53634|MENE_STAAU 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus GN=menE PE=3 SV=1 164 417 1.0E-16
sp|A8Z4L9|MENE_STAAT 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menE PE=3 SV=1 164 417 1.0E-16
sp|A6QHX6|MENE_STAAE 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Newman) GN=menE PE=3 SV=1 164 417 1.0E-16
sp|Q5HEY2|MENE_STAAC 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain COL) GN=menE PE=3 SV=1 164 417 1.0E-16
sp|Q2G2V3|MENE_STAA8 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=menE PE=3 SV=1 164 417 1.0E-16
sp|Q2FFU9|MENE_STAA3 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300) GN=menE PE=3 SV=1 164 417 1.0E-16
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 169 508 2.0E-16
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 164 507 2.0E-16
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 61 418 2.0E-16
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 165 440 2.0E-16
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 61 418 2.0E-16
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 61 418 2.0E-16
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 61 418 2.0E-16
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 145 420 2.0E-16
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 46 424 2.0E-16
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 61 418 2.0E-16
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 169 499 2.0E-16
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 169 508 2.0E-16
sp|Q8CS21|MENE_STAES 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menE PE=3 SV=1 164 417 2.0E-16
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 60 417 2.0E-16
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 60 518 3.0E-16
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 154 502 3.0E-16
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 154 502 3.0E-16
sp|P18163|ACSL1_RAT Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus GN=Acsl1 PE=1 SV=1 146 443 4.0E-16
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 164 507 4.0E-16
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 21 422 6.0E-16
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 164 508 7.0E-16
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 164 508 7.0E-16
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 133 509 7.0E-16
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 167 509 8.0E-16
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 60 422 8.0E-16
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 156 422 9.0E-16
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 162 502 9.0E-16
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 61 494 1.0E-15
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 158 511 1.0E-15
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 49 428 1.0E-15
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 49 428 1.0E-15
sp|Q9UKU0|ACSL6_HUMAN Long-chain-fatty-acid--CoA ligase 6 OS=Homo sapiens GN=ACSL6 PE=2 SV=4 151 433 1.0E-15
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 129 420 2.0E-15
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 61 418 2.0E-15
sp|O22898|LACS1_ARATH Long chain acyl-CoA synthetase 1 OS=Arabidopsis thaliana GN=LACS1 PE=2 SV=1 151 418 2.0E-15
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 88 510 2.0E-15
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 60 451 2.0E-15
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 159 519 3.0E-15
sp|Q8LPS1|LACS6_ARATH Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana GN=LACS6 PE=1 SV=1 146 433 3.0E-15
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 53 505 3.0E-15
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 61 494 4.0E-15
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 53 505 4.0E-15
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 61 418 5.0E-15
sp|P33121|ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens GN=ACSL1 PE=1 SV=1 140 443 8.0E-15
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 229 516 9.0E-15
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 164 508 9.0E-15
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 21 422 1.0E-14
sp|O05598|Y1013_MYCTU Putative ligase Rv1013 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks16 PE=1 SV=2 164 419 1.0E-14
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 84 422 2.0E-14
sp|A4WJG1|ACSA_PYRAR Acetyl-coenzyme A synthetase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=acsA PE=3 SV=1 157 502 3.0E-14
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 598 745 3.0E-14
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 164 508 4.0E-14
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 164 502 5.0E-14
sp|Q5ZKR7|ACBG2_CHICK Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus GN=ACSBG2 PE=2 SV=2 144 423 6.0E-14
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 163 421 6.0E-14
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 164 495 8.0E-14
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 151 434 9.0E-14
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 149 420 9.0E-14
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 149 420 9.0E-14
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 16 510 1.0E-13
sp|Q9LQ12|4CLL1_ARATH 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 60 417 1.0E-13
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 164 421 1.0E-13
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 159 510 1.0E-13
sp|Q82SI5|ACSA_NITEU Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 151 523 1.0E-13
sp|O68040|ACSA_RHOCB Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 135 502 2.0E-13
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 60 417 2.0E-13
sp|Q8LKS5|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 158 433 2.0E-13
sp|A0R3D6|Y5435_MYCS2 Putative ligase MSMEG_5435/MSMEI_5285 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_5435 PE=1 SV=1 155 419 2.0E-13
sp|B2HHZ8|FAC17_MYCMM Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD17 PE=3 SV=1 165 506 2.0E-13
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 164 495 3.0E-13
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 596 745 3.0E-13
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 162 505 4.0E-13
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 162 519 4.0E-13
sp|B2HGV4|FAC15_MYCMM Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD15 PE=3 SV=1 165 420 5.0E-13
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 165 508 5.0E-13
sp|Q5SIW6|ACSA_THET8 Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=acsA PE=3 SV=1 150 502 5.0E-13
sp|Q2G512|ACSA_NOVAD Acetyl-coenzyme A synthetase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=acsA PE=3 SV=1 157 522 1.0E-12
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 163 508 1.0E-12
sp|C1AA44|ACSA_GEMAT Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 152 502 1.0E-12
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 159 434 1.0E-12
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 150 517 1.0E-12
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 159 508 1.0E-12
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 159 508 1.0E-12
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 159 508 1.0E-12
sp|Q00594|ALKK_PSEOL Medium-chain-fatty-acid--CoA ligase OS=Pseudomonas oleovorans GN=alkK PE=3 SV=1 162 510 1.0E-12
sp|Q9C9G2|AEE22_ARATH Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 161 505 1.0E-12
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 161 516 2.0E-12
sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 155 420 2.0E-12
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 165 422 2.0E-12
sp|A0KNI2|ACSA_AERHH Acetyl-coenzyme A synthetase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=acsA PE=3 SV=1 158 518 2.0E-12
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 163 508 3.0E-12
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 130 502 3.0E-12
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 165 516 3.0E-12
sp|Q0AFF1|ACSA_NITEC Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 168 523 4.0E-12
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 130 502 4.0E-12
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 150 502 4.0E-12
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 150 502 4.0E-12
sp|Q98ET8|ACSA_RHILO Acetyl-coenzyme A synthetase OS=Rhizobium loti (strain MAFF303099) GN=acsA PE=3 SV=1 157 545 4.0E-12
sp|Q7F1X5|4CLL5_ORYSJ 4-coumarate--CoA ligase-like 5 OS=Oryza sativa subsp. japonica GN=4CLL5 PE=2 SV=1 25 422 4.0E-12
sp|Q72J95|ACSA_THET2 Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=acsA PE=3 SV=1 150 502 4.0E-12
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 154 502 5.0E-12
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 169 502 5.0E-12
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 26 516 5.0E-12
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 168 510 7.0E-12
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 169 495 8.0E-12
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 163 511 9.0E-12
sp|O53521|FAC15_MYCTU Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD15 PE=1 SV=3 165 420 1.0E-11
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 142 422 1.0E-11
sp|A4SJM6|ACSA_AERS4 Acetyl-coenzyme A synthetase OS=Aeromonas salmonicida (strain A449) GN=acsA PE=3 SV=1 18 518 2.0E-11
sp|Q3SLF4|ACSA_THIDA Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 168 517 2.0E-11
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 88 510 2.0E-11
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 169 422 2.0E-11
sp|Q9T0A0|LACS4_ARATH Long chain acyl-CoA synthetase 4 OS=Arabidopsis thaliana GN=LACS4 PE=2 SV=1 144 418 2.0E-11
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 16 417 2.0E-11
sp|B8FIN2|ACSA_DESAA Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 37 514 3.0E-11
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 157 523 3.0E-11
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 57 428 3.0E-11
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 160 505 4.0E-11
sp|Q89WV5|ACSA_BRADU Acetyl-coenzyme A synthetase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acsA PE=1 SV=2 162 502 4.0E-11
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 158 433 4.0E-11
sp|Q5FVE4|ACBG2_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Homo sapiens GN=ACSBG2 PE=1 SV=2 144 420 4.0E-11
sp|A1SZA2|ACSA_PSYIN Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 37 518 4.0E-11
sp|B9DGD6|ACS_ARATH Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal OS=Arabidopsis thaliana GN=ACS PE=1 SV=1 162 502 4.0E-11
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 168 510 5.0E-11
sp|Q7TYX8|FAC15_MYCBO Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD15 PE=3 SV=2 165 420 5.0E-11
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 35 517 5.0E-11
sp|O53551|FAC17_MYCTU Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD17 PE=1 SV=1 59 506 5.0E-11
sp|Q7TWC5|FAC17_MYCBO Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD17 PE=3 SV=1 59 506 5.0E-11
sp|A7HSR8|ACSA_PARL1 Acetyl-coenzyme A synthetase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=acsA PE=3 SV=1 158 548 6.0E-11
sp|A0L576|ACSA_MAGMM Acetyl-coenzyme A synthetase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=acsA PE=3 SV=1 158 502 6.0E-11
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 88 510 7.0E-11
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 58 422 7.0E-11
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 150 502 8.0E-11
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 161 495 8.0E-11
sp|A7IFD4|ACSA_XANP2 Acetyl-coenzyme A synthetase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acsA PE=3 SV=1 163 502 8.0E-11
sp|Q9V3S9|BGM_DROME Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster GN=bgm PE=2 SV=1 164 420 9.0E-11
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 161 502 9.0E-11
sp|Q9SFW5|AEE21_ARATH Probable acyl-activating enzyme 21 OS=Arabidopsis thaliana GN=AEE21 PE=3 SV=1 144 434 9.0E-11
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 165 508 1.0E-10
sp|Q87C00|ACSA_XYLFT Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acsA PE=3 SV=1 158 502 1.0E-10
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 164 495 1.0E-10
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 164 421 1.0E-10
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 58 422 1.0E-10
sp|Q2XU92|ACBG2_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus GN=Acsbg2 PE=1 SV=1 144 420 1.0E-10
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 33 510 2.0E-10
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 169 508 2.0E-10
sp|Q72LY9|ACSA_LEPIC Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=acsA PE=3 SV=1 157 502 2.0E-10
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 86 422 2.0E-10
sp|Q8EYG2|ACSA_LEPIN Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=acsA PE=3 SV=1 157 502 2.0E-10
sp|Q9HV66|ACSA2_PSEAE Acetyl-coenzyme A synthetase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA2 PE=3 SV=1 162 514 2.0E-10
sp|A9WWT6|ACSA_BRUSI Acetyl-coenzyme A synthetase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=acsA PE=3 SV=1 157 515 2.0E-10
sp|Q8FYQ3|ACSA_BRUSU Acetyl-coenzyme A synthetase OS=Brucella suis biovar 1 (strain 1330) GN=acsA PE=3 SV=1 157 515 2.0E-10
sp|A9M849|ACSA_BRUC2 Acetyl-coenzyme A synthetase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=acsA PE=3 SV=1 157 515 2.0E-10
sp|Q57B76|ACSA_BRUAB Acetyl-coenzyme A synthetase OS=Brucella abortus biovar 1 (strain 9-941) GN=acsA PE=3 SV=1 157 515 2.0E-10
sp|Q2YLH5|ACSA_BRUA2 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain 2308) GN=acsA PE=3 SV=1 157 515 2.0E-10
sp|B2S7N5|ACSA_BRUA1 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain S19) GN=acsA PE=3 SV=1 157 515 2.0E-10
sp|Q056J9|ACSA_LEPBL Acetyl-coenzyme A synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=acsA PE=3 SV=1 157 433 3.0E-10
sp|Q924N5|ACBG1_RAT Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus GN=Acsbg1 PE=1 SV=1 347 420 3.0E-10
sp|Q8YJ48|ACSA_BRUME Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=acsA PE=3 SV=2 157 515 3.0E-10
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 169 510 3.0E-10
sp|Q04P35|ACSA_LEPBJ Acetyl-coenzyme A synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=acsA PE=3 SV=1 157 433 3.0E-10
sp|A6WXV8|ACSA_OCHA4 Acetyl-coenzyme A synthetase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=acsA PE=3 SV=1 158 515 3.0E-10
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 144 422 4.0E-10
sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=acsA PE=3 SV=1 157 502 5.0E-10
sp|Q99PU5|ACBG1_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Mus musculus GN=Acsbg1 PE=1 SV=1 347 420 5.0E-10
sp|A1WY97|ACSA_HALHL Acetyl-coenzyme A synthetase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=acsA PE=3 SV=1 158 502 5.0E-10
sp|Q9PB89|ACSA_XYLFA Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain 9a5c) GN=acsA PE=3 SV=1 158 502 5.0E-10
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 61 513 5.0E-10
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 36 433 7.0E-10
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 600 751 7.0E-10
sp|A4YGR1|HPCAS_METS5 3-hydroxypropionyl-coenzyme A synthetase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1456 PE=1 SV=1 151 502 8.0E-10
sp|A1L1K7|ACBG2_RAT Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Rattus norvegicus GN=Acsbg2 PE=2 SV=1 144 420 8.0E-10
sp|Q9C7W4|LACS3_ARATH Long chain acyl-CoA synthetase 3 OS=Arabidopsis thaliana GN=LACS3 PE=2 SV=1 144 418 1.0E-09
sp|P78773|ACSA_SCHPO Probable acetyl-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC191.02c PE=1 SV=2 168 510 1.0E-09
sp|Q07VK4|ACSA_RHOP5 Acetyl-coenzyme A synthetase OS=Rhodopseudomonas palustris (strain BisA53) GN=acsA PE=3 SV=1 159 502 1.0E-09
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 162 421 1.0E-09
sp|Q21LV0|ACSA_SACD2 Acetyl-coenzyme A synthetase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=acsA PE=3 SV=1 142 514 1.0E-09
sp|C0RF62|ACSA_BRUMB Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=acsA PE=3 SV=1 157 515 1.0E-09
sp|Q9SEY5|AAE2_ARATH Probable acyl-activating enzyme 2 OS=Arabidopsis thaliana GN=AAE2 PE=2 SV=1 162 434 2.0E-09
sp|B0SRX5|ACSA_LEPBP Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=acsA PE=3 SV=1 160 502 2.0E-09
sp|B0S8X7|ACSA_LEPBA Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=acsA PE=3 SV=1 160 502 2.0E-09
sp|B2HIL6|FAA22_MYCMM p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD22 PE=1 SV=1 164 505 2.0E-09
sp|Q2KHW5|ACBG1_BOVIN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Bos taurus GN=ACSBG1 PE=2 SV=1 347 420 2.0E-09
sp|Q88DW6|ACSA2_PSEPK Acetyl-coenzyme A synthetase 2 OS=Pseudomonas putida (strain KT2440) GN=acsA2 PE=3 SV=1 148 514 2.0E-09
sp|Q9A2I0|ACSA_CAUCR Acetyl-coenzyme A synthetase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=acsA PE=3 SV=1 158 515 2.0E-09
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 150 518 3.0E-09
sp|Q4R4P9|ACBG1_MACFA Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Macaca fascicularis GN=ACSBG1 PE=2 SV=2 347 420 4.0E-09
sp|Q96GR2|ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens GN=ACSBG1 PE=2 SV=2 347 420 4.0E-09
sp|Q7N7A9|AAS_PHOLL Bifunctional protein Aas OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aas PE=3 SV=1 161 407 4.0E-09
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 18 502 4.0E-09
sp|P9WQ39|MENE_MYCTU Probable 2-succinylbenzoate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menE PE=1 SV=1 164 509 5.0E-09
sp|P9WQ38|MENE_MYCTO Probable 2-succinylbenzoate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menE PE=3 SV=1 164 509 5.0E-09
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 156 502 5.0E-09
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 163 495 7.0E-09
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 171 433 7.0E-09
sp|Q6G1W0|ACSA_BARHE Acetyl-coenzyme A synthetase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=acsA PE=3 SV=1 163 433 7.0E-09
sp|A4YK73|ACSA_BRASO Acetyl-coenzyme A synthetase OS=Bradyrhizobium sp. (strain ORS278) GN=acsA PE=3 SV=1 162 502 8.0E-09
sp|Q6BQF2|ACS1_DEBHA Acetyl-coenzyme A synthetase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS1 PE=3 SV=1 158 518 9.0E-09
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 579 727 1.0E-08
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 144 511 1.0E-08
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 158 510 1.0E-08
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 158 510 1.0E-08
sp|B1ZB59|ACSA_METPB Acetyl-coenzyme A synthetase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=acsA PE=3 SV=1 162 502 1.0E-08
sp|Q27549|ACSA_CRYPV Acetyl-coenzyme A synthetase OS=Cryptosporidium parvum GN=ACS PE=3 SV=1 140 502 1.0E-08
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 152 502 1.0E-08
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 171 494 1.0E-08
sp|Q6FYL4|ACSA_BARQU Acetyl-coenzyme A synthetase OS=Bartonella quintana (strain Toulouse) GN=acsA PE=3 SV=1 162 502 1.0E-08
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 158 510 1.0E-08
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 602 750 1.0E-08
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 602 750 1.0E-08
sp|Q0VSR6|ACSA_ALCBS Acetyl-coenzyme A synthetase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=acsA PE=3 SV=1 157 514 1.0E-08
sp|B2HI05|FAC19_MYCMM Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 159 495 2.0E-08
sp|Q1QEB6|ACSA_PSYCK Acetyl-coenzyme A synthetase OS=Psychrobacter cryohalolentis (strain K5) GN=acsA PE=3 SV=1 150 443 2.0E-08
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 164 508 3.0E-08
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 580 728 3.0E-08
sp|Q9V3U0|BGML_DROME Long-chain-fatty-acid--CoA ligase bubblegum-like OS=Drosophila melanogaster GN=CG4500 PE=2 SV=1 348 420 3.0E-08
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 569 729 4.0E-08
sp|Q6LLZ1|ACSA_PHOPR Acetyl-coenzyme A synthetase OS=Photobacterium profundum GN=acsA PE=3 SV=1 157 502 4.0E-08
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 163 502 4.0E-08
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 163 502 4.0E-08
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 125 495 4.0E-08
sp|A1UR36|ACSA_BARBK Acetyl-coenzyme A synthetase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=acsA PE=3 SV=1 158 502 4.0E-08
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 161 439 4.0E-08
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 156 502 4.0E-08
sp|P16928|ACSA_EMENI Acetyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=facA PE=2 SV=2 150 522 5.0E-08
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 156 502 5.0E-08
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 144 418 5.0E-08
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 152 433 5.0E-08
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 61 417 6.0E-08
sp|Q60714|S27A1_MOUSE Long-chain fatty acid transport protein 1 OS=Mus musculus GN=Slc27a1 PE=1 SV=1 145 552 6.0E-08
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 161 422 7.0E-08
sp|P9WQ53|FAD11_MYCTU Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD11 PE=3 SV=1 162 423 7.0E-08
sp|P9WQ52|FAD11_MYCTO Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD11 PE=3 SV=1 162 423 7.0E-08
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 601 738 7.0E-08
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 575 729 8.0E-08
sp|A9IYZ3|ACSA_BART1 Acetyl-coenzyme A synthetase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=acsA PE=3 SV=1 159 502 8.0E-08
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 161 439 8.0E-08
sp|A9W5V0|ACSA_METEP Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain PA1) GN=acsA PE=3 SV=1 162 502 8.0E-08
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 601 727 8.0E-08
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 599 736 9.0E-08
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 599 736 9.0E-08
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 601 761 1.0E-07
sp|P77495|PRPE_ECOLI Propionate--CoA ligase OS=Escherichia coli (strain K12) GN=prpE PE=3 SV=1 162 502 1.0E-07
sp|P55912|PRPE_SALTY Propionate--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpE PE=3 SV=2 162 502 1.0E-07
sp|Q92KX2|ACSA_RHIME Acetyl-coenzyme A synthetase OS=Rhizobium meliloti (strain 1021) GN=acsA1 PE=3 SV=1 158 502 1.0E-07
sp|Q14DH7|ACSS3_MOUSE Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Mus musculus GN=Acss3 PE=1 SV=2 169 452 1.0E-07
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 144 511 1.0E-07
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 146 420 1.0E-07
sp|Q9H6R3|ACSS3_HUMAN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens GN=ACSS3 PE=1 SV=1 169 452 1.0E-07
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 325 509 1.0E-07
sp|O88561|S27A3_MOUSE Long-chain fatty acid transport protein 3 OS=Mus musculus GN=Slc27a3 PE=1 SV=2 160 433 1.0E-07
sp|Q2LW77|ACSA_SYNAS Acetyl-coenzyme A synthetase OS=Syntrophus aciditrophicus (strain SB) GN=acsA PE=3 SV=1 158 502 1.0E-07
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 166 422 1.0E-07
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 601 734 1.0E-07
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 601 734 1.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 165 505 2.0E-07
sp|Q9KWA3|ACSA_AGRRH Acetyl-coenzyme A synthetase OS=Agrobacterium rhizogenes GN=acsA PE=3 SV=1 158 549 2.0E-07
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 589 727 2.0E-07
sp|B1M0M1|ACSA_METRJ Acetyl-coenzyme A synthetase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=acsA PE=3 SV=1 168 545 2.0E-07
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 168 520 2.0E-07
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 171 511 2.0E-07
sp|P9WQ51|FAC19_MYCTU Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD19 PE=1 SV=1 141 495 2.0E-07
sp|P9WQ50|FAC19_MYCTO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD19 PE=3 SV=1 141 495 2.0E-07
sp|Q7TWB7|FAC19_MYCBO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD19 PE=3 SV=1 141 495 2.0E-07
sp|Q6P461|ACSM6_HUMAN Acyl-coenzyme A synthetase ACSM6, mitochondrial OS=Homo sapiens GN=ACSM6 PE=2 SV=3 63 409 2.0E-07
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 158 502 2.0E-07
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 163 502 2.0E-07
sp|B7KPN8|ACSA_METC4 Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=acsA PE=3 SV=1 162 502 2.0E-07
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 164 505 3.0E-07
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 57 505 3.0E-07
sp|A1JIK3|ACSA_YERE8 Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acs PE=3 SV=1 158 502 3.0E-07
sp|Q5REB8|ACSS3_PONAB Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Pongo abelii GN=ACSS3 PE=2 SV=1 169 452 3.0E-07
sp|Q4FVA1|ACSA_PSYA2 Acetyl-coenzyme A synthetase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=acsA PE=3 SV=1 157 433 3.0E-07
sp|P97849|S27A1_RAT Long-chain fatty acid transport protein 1 OS=Rattus norvegicus GN=Slc27a1 PE=2 SV=1 164 490 3.0E-07
sp|A6UED8|ACSA_SINMW Acetyl-coenzyme A synthetase OS=Sinorhizobium medicae (strain WSM419) GN=acsA PE=3 SV=1 158 548 3.0E-07
sp|Q084J4|ACSA_SHEFN Acetyl-coenzyme A synthetase OS=Shewanella frigidimarina (strain NCIMB 400) GN=acsA PE=3 SV=1 157 507 3.0E-07
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 4 439 4.0E-07
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 570 737 4.0E-07
sp|B9JEV4|ACSA_AGRRK Acetyl-coenzyme A synthetase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=acsA PE=3 SV=1 158 549 4.0E-07
sp|B8EPJ0|ACSA_METSB Acetyl-coenzyme A synthetase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=acsA PE=3 SV=1 162 502 4.0E-07
sp|Q2NR28|ACSA_SODGM Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 158 502 4.0E-07
sp|Q54Z60|ACSA_DICDI Acetyl-coenzyme A synthetase OS=Dictyostelium discoideum GN=acsA PE=3 SV=1 162 513 4.0E-07
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 138 434 4.0E-07
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 158 502 5.0E-07
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 57 425 6.0E-07
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 600 728 6.0E-07
sp|Q12MK0|ACSA_SHEDO Acetyl-coenzyme A synthetase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=acsA PE=3 SV=1 162 502 6.0E-07
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 158 502 6.0E-07
sp|E3UUE6|FAC19_RHORH 3-oxocholest-4-en-26-oate--CoA ligase OS=Rhodococcus rhodochrous GN=fadD19 PE=1 SV=1 134 495 6.0E-07
sp|Q8UBV5|ACSA_AGRFC Acetyl-coenzyme A synthetase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=acsA PE=3 SV=2 158 433 6.0E-07
sp|Q7ZYC4|ACBG2_XENLA Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopus laevis GN=acsbg2 PE=2 SV=1 144 420 7.0E-07
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 601 724 8.0E-07
sp|Q0AAW0|ACSA_ALKEH Acetyl-coenzyme A synthetase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=acsA PE=3 SV=1 162 514 8.0E-07
sp|B2IB12|ACSA_BEII9 Acetyl-coenzyme A synthetase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=acsA PE=3 SV=1 162 502 9.0E-07
sp|A8G8G7|ACSA_SERP5 Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) GN=acs PE=3 SV=1 158 502 9.0E-07
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 601 761 1.0E-06
sp|Q9NR19|ACSA_HUMAN Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens GN=ACSS2 PE=1 SV=1 157 434 1.0E-06
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 601 731 1.0E-06
sp|Q554Z5|ACSB_DICDI Acyl-CoA synthetase short-chain family member B, mitochondrial OS=Dictyostelium discoideum GN=aslB PE=3 SV=1 169 459 1.0E-06
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 158 517 1.0E-06
sp|Q87KU7|ACSA_VIBPA Acetyl-coenzyme A synthetase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=acsA PE=3 SV=1 158 502 1.0E-06
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 134 505 2.0E-06
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 164 498 2.0E-06
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 93 502 2.0E-06
sp|A1U2S9|ACSA_MARHV Acetyl-coenzyme A synthetase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=acsA PE=3 SV=1 157 502 2.0E-06
sp|Q9F7R5|ACSA_PRB01 Acetyl-coenzyme A synthetase OS=Gamma-proteobacterium EBAC31A08 GN=acsA PE=3 SV=1 158 502 2.0E-06
sp|A3QD52|ACSA_SHELP Acetyl-coenzyme A synthetase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=acsA PE=3 SV=1 163 502 2.0E-06
sp|O25686|ACSA_HELPY Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=acsA PE=3 SV=1 157 443 2.0E-06
sp|Q6PCB7|S27A1_HUMAN Long-chain fatty acid transport protein 1 OS=Homo sapiens GN=SLC27A1 PE=2 SV=1 164 490 2.0E-06
sp|P9WQ41|MBTM_MYCTU Long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtM PE=1 SV=1 160 417 2.0E-06
sp|P0A4X9|MBTM_MYCBO Long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtM PE=3 SV=1 160 417 2.0E-06
sp|B5Z6E9|ACSA_HELPG Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain G27) GN=acsA PE=3 SV=1 157 443 3.0E-06
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 599 730 3.0E-06
sp|P9WQ40|MBTM_MYCTO Long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtM PE=3 SV=1 160 417 3.0E-06
sp|A1RIK1|ACSA_SHESW Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain W3-18-1) GN=acsA PE=3 SV=1 157 502 3.0E-06
sp|Q17WR1|ACSA_HELAH Acetyl-coenzyme A synthetase OS=Helicobacter acinonychis (strain Sheeba) GN=acsA PE=3 SV=1 157 443 3.0E-06
sp|A4Y7Y7|ACSA_SHEPC Acetyl-coenzyme A synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=acsA PE=3 SV=1 157 502 3.0E-06
sp|Q9LK39|AAE16_ARATH Probable acyl-activating enzyme 16, chloroplastic OS=Arabidopsis thaliana GN=AAE16 PE=2 SV=1 289 419 3.0E-06
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 573 727 4.0E-06
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 595 750 4.0E-06
sp|A1S7C8|ACSA_SHEAM Acetyl-coenzyme A synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=acsA PE=3 SV=1 163 502 4.0E-06
sp|A7MB45|ACSS3_BOVIN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Bos taurus GN=ACSS3 PE=2 SV=1 169 458 4.0E-06
sp|Q8W471|AAE15_ARATH Long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15, chloroplastic OS=Arabidopsis thaliana GN=AAE15 PE=1 SV=1 289 419 4.0E-06
sp|B5ZV36|ACSA_RHILW Acetyl-coenzyme A synthetase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=acsA PE=3 SV=1 158 548 5.0E-06
sp|Q7M9Y2|ACSA_WOLSU Acetyl-coenzyme A synthetase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=acsA PE=3 SV=1 158 517 5.0E-06
sp|Q0HTY6|ACSA_SHESR Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 163 502 6.0E-06
sp|Q0HHN4|ACSA_SHESM Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 163 502 6.0E-06
sp|A4TS06|ACSA_YERPP Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 158 502 7.0E-06
sp|Q1CE37|ACSA_YERPN Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acs PE=3 SV=1 158 502 7.0E-06
sp|Q8D1G8|ACSA_YERPE Acetyl-coenzyme A synthetase OS=Yersinia pestis GN=acs PE=3 SV=2 158 502 7.0E-06
sp|Q1C0N0|ACSA_YERPA Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acs PE=3 SV=1 158 502 7.0E-06
sp|A0KY83|ACSA_SHESA Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain ANA-3) GN=acsA PE=3 SV=1 163 502 7.0E-06
sp|Q66FM8|ACSA_YERPS Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 158 502 7.0E-06
sp|A7FNG1|ACSA_YERP3 Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 158 502 7.0E-06
sp|Q2K2T1|ACSA_RHIEC Acetyl-coenzyme A synthetase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=acsA PE=3 SV=1 158 548 7.0E-06
sp|Q8EDK3|ACSA_SHEON Acetyl-coenzyme A synthetase OS=Shewanella oneidensis (strain MR-1) GN=acsA PE=3 SV=1 163 502 8.0E-06
sp|A6WM52|ACSA_SHEB8 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 157 502 1.0E-05
sp|A3D3E8|ACSA_SHEB5 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 157 502 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

Domain # Start End Length
1 998 1020 22
2 1041 1063 22
3 1276 1298 22
4 1311 1333 22
5 1337 1359 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8061
MATHTTQLVKGSYKSFHHLIPRDCRPALWNAASGTFISHRQLYDFVADFSLPGTAPPRPVVAIALPNGPLLAAVC
FAVTTYYTAAPINPVAGAEQFRADVTLAGAQLILTTADEYDKLQLGEPWVRDGDIRVVCVSCDDGGNIELVAAGE
GLPRPQRPKPNEADDISLLLFTSGTSGKKKVVPITTHSLIVGIVGVIDSWGLTSTDICLNMMPLYHIGGLVRNVF
APVFSAGSTVCCAAFDPDLFWDVMEEMQPTWYYASPSMHSLILEQASQRPAALQRSRMRLVCNAAGGLLPTLAYR
LRETFRCVVLPSYGMTELDREGTSGVSCGPELTVLDSSEAPVRPGTIGRVCVRGEPVFPGYLRPDGSIDKETAFT
SHGWFDTGDLGYMDPDGYLYITGRSKEVVNRGGELISPFEVENAIVSAAQSPESPIHGRVAGALAFSVQHEVLQE
VVGVVLLTPVDQPRVDLRALHQALESSLQQVKWPVLIVFMDDLPRKNNKVLRIGLSRRLGLLELGQDDVPYLQRH
WEADCPPVDTDLSVPIPSRQCSADYRLLSEALDAAVPVGFCHCCRTNAADHAIEAIVAPASTEGSKTTLSSGFAD
ELRRLLSGRIHNYLVPDRIHVLSEPLPMNQDGHADEAHLQALVDEMLSASLDDDSTSRTETEVAKVFAQVLGRYP
GEIPLDLDFFSLGGDSLRAGRLVSTLRHEFNVQVPISIVFGRGTVRAVAAHIDKLKPASSDGECEEDKAAPVGCA
DGTKSSTNPFLMALQLSPLVVFCPLRYSFQWAIFIAMLSQSHAWPTAGSPVGLLANLVFSIIFARAVLRLVAPFF
GIAAKWLIVGRYAEGLYPMWGGYHTRWWLVQKIEAICGKGIFNINDSTLRIYYILMGARIGRRVRLQGAALGEWD
LLDIGDDAILAGGCVCRPFAVEGNTTMYLGRIKIGEKSSINVSSVLAPGSDIPPNTHIGPNSSSWEMADATEENG
DLNARKASGPHWLLTVLLTAPLLSVAWILSLLPWIAGLLGMVLPGKHVVPFMVRGTLAWFTTDTRLAFHYLALAL
KVIGPFFLLGFAVLLRLLLDGLFGKLESGSSRGRGAWATWRQSLMKTLMPMRQLQQVTAMFGKHYEATSIVLRLL
GSRIGKRVYWPGTGPYIGDYHLLDIGDDVVFGSRSYLLTSDGVGSDTITVRDGAMIADRVCLLPGADVGRQTTMG
SGALGRKGKKYDDGATYVGSQAGDAVLLSTGRDGAERSRRSRALVMPGEKPSDDTLAETASPFGRAFYYKLAPYY
VFSPSLIFFYSVLTTVLAVLYWNLPIICSTQIAHTLMSRYIPVLGFWAEVATTLGIIFPLTAILMTIQAVVALMI
VIAAKWSLLGRRQPGNYDWDKSSYCQRWQLFLAIEKIRQVSFSGQGILGLLTGTHWMVLYFRAMGATIGDDCALF
ANGCPSVMFTEPDLISLGSRVAVDDASIVAHVNTRGTFNLNRIEVGNS*
Coding >Hirsu2|8061
ATGGCCACCCATACCACTCAGCTGGTCAAGGGCTCGTACAAATCCTTCCACCACCTCATCCCCCGCGACTGCCGG
CCGGCTCTGTGGAACGCAGCTTCAGGCACCTTCATCAGCCACCGGCAACTTTACGACTTCGTGGCTGATTTCAGT
CTGCCTGGCACGGCCCCGCCGAGGCCGGTGGTCGCGATAGCCCTGCCGAATGGCCCGCTGCTCGCGGCGGTGTGC
TTCGCAGTAACGACCTATTATACCGCGGCTCCTATCAACCCGGTCGCGGGAGCCGAACAGTTCCGGGCCGACGTA
ACACTGGCTGGTGCCCAACTGATACTCACGACAGCTGACGAGTACGACAAGCTACAGCTTGGAGAACCATGGGTT
CGCGATGGAGATATTCGAGTCGTTTGCGTAAGCTGCGACGACGGCGGCAACATCGAGCTTGTTGCTGCCGGAGAG
GGGCTTCCGCGTCCGCAACGGCCGAAGCCCAACGAGGCGGACGACATCAGCCTCCTGCTCTTCACCAGCGGGACG
TCTGGCAAGAAGAAAGTGGTCCCAATAACAACGCATTCACTTATCGTGGGCATCGTCGGCGTGATCGACTCCTGG
GGCTTGACCTCAACGGACATCTGCCTGAACATGATGCCCCTGTATCACATAGGTGGCCTGGTCAGGAACGTCTTT
GCGCCCGTCTTCTCCGCAGGTTCGACCGTCTGCTGCGCCGCATTCGACCCCGACCTGTTTTGGGACGTTATGGAA
GAGATGCAGCCCACGTGGTACTACGCCTCGCCGTCTATGCACTCTCTTATTCTCGAGCAAGCTTCACAGCGGCCG
GCGGCCCTGCAACGGAGCCGAATGAGACTTGTCTGCAATGCCGCCGGCGGACTATTGCCCACTCTGGCCTATCGC
CTGCGCGAGACCTTCCGCTGCGTGGTTTTGCCGAGCTACGGGATGACAGAGCTCGACCGCGAAGGCACGTCTGGC
GTAAGCTGCGGCCCCGAGCTAACGGTCCTGGATTCCTCTGAAGCCCCGGTCCGACCCGGGACGATTGGTCGGGTT
TGTGTACGAGGCGAGCCCGTCTTCCCAGGCTATCTGCGGCCCGACGGTTCCATAGACAAGGAGACAGCCTTTACT
TCGCATGGCTGGTTCGATACCGGCGACTTGGGCTATATGGACCCGGACGGCTATCTTTACATCACCGGTCGAAGC
AAAGAAGTGGTCAACCGCGGTGGGGAGCTTATATCGCCGTTCGAGGTTGAAAATGCAATCGTCTCGGCGGCGCAG
TCTCCGGAATCGCCCATACACGGCCGCGTCGCCGGCGCCCTGGCCTTCTCCGTCCAGCATGAAGTCCTCCAGGAG
GTCGTTGGAGTCGTGCTCCTCACGCCGGTCGATCAACCCCGAGTCGACCTCAGGGCGCTCCACCAAGCGCTAGAA
TCGTCGCTTCAGCAGGTCAAGTGGCCCGTGCTGATTGTCTTCATGGACGACCTGCCCCGGAAGAATAACAAGGTG
CTGCGTATCGGGCTGAGCCGGCGGCTGGGCTTGCTCGAGCTCGGACAGGACGACGTCCCGTATCTGCAGAGACAC
TGGGAGGCTGATTGCCCGCCCGTCGACACGGATCTCTCGGTCCCGATCCCCAGCCGGCAATGCTCCGCCGACTAT
CGACTGCTGAGCGAGGCTTTGGACGCCGCCGTGCCTGTCGGGTTCTGTCACTGCTGTCGGACGAACGCTGCAGAC
CATGCCATCGAGGCCATAGTGGCGCCAGCGTCGACGGAGGGCTCCAAGACGACGCTGTCGTCCGGGTTCGCCGAT
GAGCTGCGACGGCTTCTGTCCGGCCGCATACATAATTACCTGGTGCCGGACAGAATTCACGTGCTTTCCGAGCCG
CTGCCGATGAACCAGGACGGGCACGCGGACGAGGCGCATCTCCAGGCACTGGTCGACGAGATGCTGTCCGCGTCG
CTCGACGACGACTCGACTAGTCGTACGGAGACGGAAGTTGCCAAAGTTTTCGCCCAAGTGCTCGGCCGCTATCCC
GGCGAGATCCCACTTGATCTCGACTTCTTCAGCCTGGGCGGAGACTCTCTACGGGCCGGCCGCCTGGTCTCAACC
CTGCGCCACGAGTTCAACGTGCAGGTGCCCATCAGCATCGTCTTCGGCCGGGGGACCGTCCGGGCGGTTGCGGCG
CACATAGACAAGCTGAAGCCGGCGAGCTCCGACGGCGAATGCGAAGAAGACAAGGCCGCGCCCGTCGGCTGCGCT
GACGGCACCAAGAGCTCGACCAACCCGTTCCTTATGGCCCTCCAGCTGAGCCCGCTCGTCGTCTTCTGCCCGCTC
CGGTACTCGTTCCAATGGGCCATCTTCATCGCGATGCTCAGCCAGAGCCACGCGTGGCCGACGGCTGGGTCGCCG
GTCGGCCTGCTGGCCAACTTAGTCTTCAGCATCATATTTGCGCGGGCCGTTCTTCGGCTCGTCGCCCCTTTCTTC
GGCATTGCTGCTAAGTGGCTCATCGTCGGTCGCTATGCCGAAGGCCTATATCCTATGTGGGGAGGCTATCATACT
CGCTGGTGGTTAGTCCAGAAGATCGAGGCTATCTGCGGCAAGGGTATCTTTAATATTAATGACTCGACCCTTCGA
ATCTACTATATCTTAATGGGGGCCAGGATCGGCCGCCGTGTCCGGCTCCAAGGCGCCGCTTTAGGCGAGTGGGAT
CTCTTGGATATCGGGGACGATGCCATCCTGGCAGGAGGCTGCGTATGCCGGCCGTTTGCAGTTGAAGGGAATACG
ACGATGTATCTTGGCAGGATCAAGATTGGCGAGAAAAGCTCTATCAACGTCTCGTCCGTCTTGGCCCCGGGCTCT
GATATCCCTCCAAACACCCATATCGGCCCCAATTCGTCGAGCTGGGAGATGGCGGACGCAACGGAGGAAAACGGC
GACCTGAACGCCCGCAAGGCATCCGGTCCGCACTGGCTGCTCACCGTCCTGCTTACGGCGCCGTTGCTCTCTGTG
GCCTGGATCCTGTCGCTTCTCCCCTGGATTGCCGGACTGTTGGGCATGGTGCTTCCGGGCAAGCATGTGGTCCCT
TTCATGGTACGAGGCACGCTTGCCTGGTTCACGACGGACACGAGACTAGCGTTCCACTATCTCGCACTGGCCCTG
AAAGTGATCGGTCCCTTTTTTCTGTTGGGCTTTGCCGTCTTGCTTCGCCTTCTCCTCGACGGCCTCTTCGGGAAG
CTTGAGTCGGGGTCTTCCCGAGGCCGAGGCGCGTGGGCAACGTGGCGCCAGTCCCTGATGAAGACGCTGATGCCT
ATGCGGCAGCTGCAACAAGTTACGGCCATGTTCGGGAAGCATTATGAAGCTACATCTATCGTCCTCCGGCTGCTC
GGAAGCAGAATCGGAAAGCGTGTATATTGGCCCGGAACAGGTCCCTATATCGGGGACTACCATCTCCTCGATATT
GGCGACGATGTCGTGTTCGGATCTCGCTCATACCTCCTCACCTCCGATGGTGTCGGATCGGATACGATTACTGTC
CGCGATGGCGCCATGATTGCGGACCGTGTCTGCCTTCTGCCCGGGGCGGACGTTGGCAGGCAGACGACCATGGGA
TCGGGTGCCCTGGGCCGCAAGGGGAAGAAGTATGACGACGGTGCGACCTATGTCGGCTCGCAAGCCGGCGATGCC
GTCCTCCTCTCTACCGGCCGTGACGGCGCCGAGAGGAGTCGGCGTTCACGGGCGCTGGTAATGCCAGGCGAGAAG
CCTAGTGACGATACCCTTGCCGAGACGGCGTCACCCTTCGGACGCGCCTTTTACTACAAGCTTGCCCCTTACTAC
GTCTTCAGCCCATCTCTCATCTTCTTCTACTCGGTACTGACAACTGTCCTTGCCGTTCTCTACTGGAACCTTCCG
ATTATCTGCTCAACACAGATCGCTCACACTCTCATGAGCCGGTACATCCCAGTCCTGGGCTTCTGGGCTGAAGTG
GCGACCACCCTGGGCATCATATTCCCACTGACCGCCATCCTCATGACGATCCAGGCCGTGGTAGCCCTGATGATC
GTCATCGCGGCGAAATGGAGCCTGCTGGGGCGTCGCCAGCCGGGCAACTACGATTGGGACAAGTCTTCCTACTGC
CAGCGGTGGCAGCTATTCCTAGCCATCGAGAAAATCCGCCAAGTTAGCTTTAGCGGACAGGGCATACTAGGACTT
CTGACCGGCACGCACTGGATGGTGCTGTACTTCCGGGCCATGGGCGCTACGATCGGAGATGATTGCGCCCTATTT
GCTAATGGCTGCCCGAGTGTTATGTTCACCGAGCCCGACCTGATTTCTTTAGGCAGTCGTGTGGCCGTCGACGAC
GCGAGCATCGTGGCCCATGTCAATACGCGGGGAACATTTAACCTCAATAGGATAGAAGTCGGGAATAGCTGA
Transcript >Hirsu2|8061
ATGGCCACCCATACCACTCAGCTGGTCAAGGGCTCGTACAAATCCTTCCACCACCTCATCCCCCGCGACTGCCGG
CCGGCTCTGTGGAACGCAGCTTCAGGCACCTTCATCAGCCACCGGCAACTTTACGACTTCGTGGCTGATTTCAGT
CTGCCTGGCACGGCCCCGCCGAGGCCGGTGGTCGCGATAGCCCTGCCGAATGGCCCGCTGCTCGCGGCGGTGTGC
TTCGCAGTAACGACCTATTATACCGCGGCTCCTATCAACCCGGTCGCGGGAGCCGAACAGTTCCGGGCCGACGTA
ACACTGGCTGGTGCCCAACTGATACTCACGACAGCTGACGAGTACGACAAGCTACAGCTTGGAGAACCATGGGTT
CGCGATGGAGATATTCGAGTCGTTTGCGTAAGCTGCGACGACGGCGGCAACATCGAGCTTGTTGCTGCCGGAGAG
GGGCTTCCGCGTCCGCAACGGCCGAAGCCCAACGAGGCGGACGACATCAGCCTCCTGCTCTTCACCAGCGGGACG
TCTGGCAAGAAGAAAGTGGTCCCAATAACAACGCATTCACTTATCGTGGGCATCGTCGGCGTGATCGACTCCTGG
GGCTTGACCTCAACGGACATCTGCCTGAACATGATGCCCCTGTATCACATAGGTGGCCTGGTCAGGAACGTCTTT
GCGCCCGTCTTCTCCGCAGGTTCGACCGTCTGCTGCGCCGCATTCGACCCCGACCTGTTTTGGGACGTTATGGAA
GAGATGCAGCCCACGTGGTACTACGCCTCGCCGTCTATGCACTCTCTTATTCTCGAGCAAGCTTCACAGCGGCCG
GCGGCCCTGCAACGGAGCCGAATGAGACTTGTCTGCAATGCCGCCGGCGGACTATTGCCCACTCTGGCCTATCGC
CTGCGCGAGACCTTCCGCTGCGTGGTTTTGCCGAGCTACGGGATGACAGAGCTCGACCGCGAAGGCACGTCTGGC
GTAAGCTGCGGCCCCGAGCTAACGGTCCTGGATTCCTCTGAAGCCCCGGTCCGACCCGGGACGATTGGTCGGGTT
TGTGTACGAGGCGAGCCCGTCTTCCCAGGCTATCTGCGGCCCGACGGTTCCATAGACAAGGAGACAGCCTTTACT
TCGCATGGCTGGTTCGATACCGGCGACTTGGGCTATATGGACCCGGACGGCTATCTTTACATCACCGGTCGAAGC
AAAGAAGTGGTCAACCGCGGTGGGGAGCTTATATCGCCGTTCGAGGTTGAAAATGCAATCGTCTCGGCGGCGCAG
TCTCCGGAATCGCCCATACACGGCCGCGTCGCCGGCGCCCTGGCCTTCTCCGTCCAGCATGAAGTCCTCCAGGAG
GTCGTTGGAGTCGTGCTCCTCACGCCGGTCGATCAACCCCGAGTCGACCTCAGGGCGCTCCACCAAGCGCTAGAA
TCGTCGCTTCAGCAGGTCAAGTGGCCCGTGCTGATTGTCTTCATGGACGACCTGCCCCGGAAGAATAACAAGGTG
CTGCGTATCGGGCTGAGCCGGCGGCTGGGCTTGCTCGAGCTCGGACAGGACGACGTCCCGTATCTGCAGAGACAC
TGGGAGGCTGATTGCCCGCCCGTCGACACGGATCTCTCGGTCCCGATCCCCAGCCGGCAATGCTCCGCCGACTAT
CGACTGCTGAGCGAGGCTTTGGACGCCGCCGTGCCTGTCGGGTTCTGTCACTGCTGTCGGACGAACGCTGCAGAC
CATGCCATCGAGGCCATAGTGGCGCCAGCGTCGACGGAGGGCTCCAAGACGACGCTGTCGTCCGGGTTCGCCGAT
GAGCTGCGACGGCTTCTGTCCGGCCGCATACATAATTACCTGGTGCCGGACAGAATTCACGTGCTTTCCGAGCCG
CTGCCGATGAACCAGGACGGGCACGCGGACGAGGCGCATCTCCAGGCACTGGTCGACGAGATGCTGTCCGCGTCG
CTCGACGACGACTCGACTAGTCGTACGGAGACGGAAGTTGCCAAAGTTTTCGCCCAAGTGCTCGGCCGCTATCCC
GGCGAGATCCCACTTGATCTCGACTTCTTCAGCCTGGGCGGAGACTCTCTACGGGCCGGCCGCCTGGTCTCAACC
CTGCGCCACGAGTTCAACGTGCAGGTGCCCATCAGCATCGTCTTCGGCCGGGGGACCGTCCGGGCGGTTGCGGCG
CACATAGACAAGCTGAAGCCGGCGAGCTCCGACGGCGAATGCGAAGAAGACAAGGCCGCGCCCGTCGGCTGCGCT
GACGGCACCAAGAGCTCGACCAACCCGTTCCTTATGGCCCTCCAGCTGAGCCCGCTCGTCGTCTTCTGCCCGCTC
CGGTACTCGTTCCAATGGGCCATCTTCATCGCGATGCTCAGCCAGAGCCACGCGTGGCCGACGGCTGGGTCGCCG
GTCGGCCTGCTGGCCAACTTAGTCTTCAGCATCATATTTGCGCGGGCCGTTCTTCGGCTCGTCGCCCCTTTCTTC
GGCATTGCTGCTAAGTGGCTCATCGTCGGTCGCTATGCCGAAGGCCTATATCCTATGTGGGGAGGCTATCATACT
CGCTGGTGGTTAGTCCAGAAGATCGAGGCTATCTGCGGCAAGGGTATCTTTAATATTAATGACTCGACCCTTCGA
ATCTACTATATCTTAATGGGGGCCAGGATCGGCCGCCGTGTCCGGCTCCAAGGCGCCGCTTTAGGCGAGTGGGAT
CTCTTGGATATCGGGGACGATGCCATCCTGGCAGGAGGCTGCGTATGCCGGCCGTTTGCAGTTGAAGGGAATACG
ACGATGTATCTTGGCAGGATCAAGATTGGCGAGAAAAGCTCTATCAACGTCTCGTCCGTCTTGGCCCCGGGCTCT
GATATCCCTCCAAACACCCATATCGGCCCCAATTCGTCGAGCTGGGAGATGGCGGACGCAACGGAGGAAAACGGC
GACCTGAACGCCCGCAAGGCATCCGGTCCGCACTGGCTGCTCACCGTCCTGCTTACGGCGCCGTTGCTCTCTGTG
GCCTGGATCCTGTCGCTTCTCCCCTGGATTGCCGGACTGTTGGGCATGGTGCTTCCGGGCAAGCATGTGGTCCCT
TTCATGGTACGAGGCACGCTTGCCTGGTTCACGACGGACACGAGACTAGCGTTCCACTATCTCGCACTGGCCCTG
AAAGTGATCGGTCCCTTTTTTCTGTTGGGCTTTGCCGTCTTGCTTCGCCTTCTCCTCGACGGCCTCTTCGGGAAG
CTTGAGTCGGGGTCTTCCCGAGGCCGAGGCGCGTGGGCAACGTGGCGCCAGTCCCTGATGAAGACGCTGATGCCT
ATGCGGCAGCTGCAACAAGTTACGGCCATGTTCGGGAAGCATTATGAAGCTACATCTATCGTCCTCCGGCTGCTC
GGAAGCAGAATCGGAAAGCGTGTATATTGGCCCGGAACAGGTCCCTATATCGGGGACTACCATCTCCTCGATATT
GGCGACGATGTCGTGTTCGGATCTCGCTCATACCTCCTCACCTCCGATGGTGTCGGATCGGATACGATTACTGTC
CGCGATGGCGCCATGATTGCGGACCGTGTCTGCCTTCTGCCCGGGGCGGACGTTGGCAGGCAGACGACCATGGGA
TCGGGTGCCCTGGGCCGCAAGGGGAAGAAGTATGACGACGGTGCGACCTATGTCGGCTCGCAAGCCGGCGATGCC
GTCCTCCTCTCTACCGGCCGTGACGGCGCCGAGAGGAGTCGGCGTTCACGGGCGCTGGTAATGCCAGGCGAGAAG
CCTAGTGACGATACCCTTGCCGAGACGGCGTCACCCTTCGGACGCGCCTTTTACTACAAGCTTGCCCCTTACTAC
GTCTTCAGCCCATCTCTCATCTTCTTCTACTCGGTACTGACAACTGTCCTTGCCGTTCTCTACTGGAACCTTCCG
ATTATCTGCTCAACACAGATCGCTCACACTCTCATGAGCCGGTACATCCCAGTCCTGGGCTTCTGGGCTGAAGTG
GCGACCACCCTGGGCATCATATTCCCACTGACCGCCATCCTCATGACGATCCAGGCCGTGGTAGCCCTGATGATC
GTCATCGCGGCGAAATGGAGCCTGCTGGGGCGTCGCCAGCCGGGCAACTACGATTGGGACAAGTCTTCCTACTGC
CAGCGGTGGCAGCTATTCCTAGCCATCGAGAAAATCCGCCAAGTTAGCTTTAGCGGACAGGGCATACTAGGACTT
CTGACCGGCACGCACTGGATGGTGCTGTACTTCCGGGCCATGGGCGCTACGATCGGAGATGATTGCGCCCTATTT
GCTAATGGCTGCCCGAGTGTTATGTTCACCGAGCCCGACCTGATTTCTTTAGGCAGTCGTGTGGCCGTCGACGAC
GCGAGCATCGTGGCCCATGTCAATACGCGGGGAACATTTAACCTCAATAGGATAGAAGTCGGGAATAGCTGA
Gene >Hirsu2|8061
ATGGCCACCCATACCACTCGTCAGATGCTACTCTCGCCTGCGGAGGTCTCTTCTGGAGGCGACCAAAAGCACACA
AACACAACATGCCTTACCCGCTGCCGTCCTAGAGCTGGTCAAGGGCTCGTACAAATCCTTCCACCACCTCATCCC
CCGCGACTGCCGGCCGGCTCTGTGGAACGCAGCTTCAGGCACCTTCATCAGCCACCGGCAACTTTACGACTTCGT
GGCTGATTTCAGTCTGCCTGGCACGGCCCCGCCGAGGCCGGTGGTCGCGATAGCCCTGCCGAATGGCCCGCTGCT
CGCGGCGGTGTGCTTCGCAGTAACGACCTATTATACCGCGGCTCCTATCAACCCGGTCGCGGGAGCCGAACAGTT
CCGGGCCGACGTAACACTGGCTGGTGCCCAACTGATACTCACGACAGCTGACGAGTACGACAAGCTACAGCTTGG
AGAACCATGGGTTCGCGATGGAGATATTCGAGTCGTTTGCGTAAGCTGCGACGACGGCGGCAACATCGAGCTTGT
TGCTGCCGGAGAGGGGCTTCCGCGTCCGCAACGGCCGAAGCCCAACGAGGCGGACGACATCAGCCTCCTGCTCTT
CACCAGCGGGACGTCTGGCAAGAAGAAAGTGGTCCCAATAACAACGCATTCACTTATCGTGGGCATCGTCGGCGT
GATCGACTCCTGGGGCTTGACCTCAACGGACATCTGCCTGAACATGATGCCCCTGTATCACATGTGAGCGTCAAC
GACGAAGAAGACGGGTTCAACAACTGCTGACTCCAAACCGACAGAGGTGGCCTGGTCAGGAACGTCTTTGCGCCC
GTCTTCTCCGCAGGTTCGACCGTCTGCTGCGCCGCATTCGACCCCGACCTGTTTTGGGACGTTATGGAAGAGATG
CAGCCCACGTGGTACTACGCCTCGCCGTCTATGCACTCTCTTATTCTCGAGCAAGCTTCACAGCGGCCGGCGGCC
CTGCAACGGAGCCGAATGAGACTTGTCTGCAATGCCGCCGGCGGACTATTGCCCACTCTGGCCTATCGCCTGCGC
GAGACCTTCCGCTGCGTGGTTTTGCCGAGCTACGGGATGACAGAGTATGATAACTGCACGCTCTTGAAGGGCAGT
CGCCGAACATGAAGCATTGACAGCTCTTTCTAGATGTATGCCTATTTCGACACCACCGCTGGACTACAGGCTCGA
CCGCGAAGGCACGTCTGGCGTAAGCTGCGGCCCCGAGCTAACGGTCCTGGATTCCTCTGAAGCCCCGGTCCGACC
CGGGACGATTGGTCGGGTTTGTGTACGAGGCGAGCCCGTCTTCCCAGGCTATCTGCGGCCCGACGGTTCCATAGA
CAAGGAGACAGCCTTTACTTCGCATGGCTGGTTCGATACCGGCGACTTGGGCTATATGGACCCGGACGGCTATCT
TTACATCACCGGTCGAAGCAAAGAAGTGGTCAACCGCGGTGGGGAGCTTATATCGCCGTTCGAGGTTGAAAATGC
AATCGTCTCGGCGGCGCAGTCTCCGGAATCGCCCATACACGGCCGCGTCGCCGGCGCCCTGGCCTTCTCCGTCCA
GCATGAAGTCCTCCAGGAGGTCGTTGGAGTCGTGCTCCTCACGCCGGTCGATCAACCCCGAGTCGACCTCAGGGC
GCTCCACCAAGCGCTAGAATCGTCGCTTCAGCAGGTCAAGTGGCCCGTGCTGATTGTCTTCATGGACGACCTGCC
CCGGAAGAATAACAAGGTGCTGCGTATCGGGCTGAGCCGGCGGCTGGGCTTGCTCGAGCTCGGACAGGACGACGT
CCCGTATCTGCAGAGACACTGGGAGGCTGATTGCCCGCCCGTCGACACGGATCTCTCGGTCCCGATCCCCAGCCG
GCAATGCTCCGCCGACTATCGACTGCTGAGCGAGGCTTTGGACGCCGCCGTGCCTGTCGGGTTCTGTCACTGCTG
TCGGACGAACGCTGCAGACCATGCCATCGAGGCCATAGTGGCGCCAGCGTCGACGGAGGGCTCCAAGACGACGCT
GTCGTCCGGGTTCGCCGATGAGCTGCGACGGCTTCTGTCCGGCCGCATACATAATTACCTGGTGCCGGACAGAAT
TCACGTGCTTTCCGAGCCGCTGCCGATGAACCAGGACGGGCACGCGGACGAGGCGCATCTCCAGGCACTGGTCGA
CGAGATGCTGTCCGCGTCGCTCGACGACGACTCGACTAGTCGTACGGAGACGGAAGTTGCCAAAGTTTTCGCCCA
AGTGCTCGGCCGCTATCCCGGCGAGATCCCACTTGATCTCGACTTCTTCAGCCTGGGCGGAGACTCTCTACGGGC
CGGCCGCCTGGTCTCAACCCTGCGCCACGAGTTCAACGTGCAGGTGCCCATCAGCATCGTCTTCGGCCGGGGGAC
CGTCCGGGCGGTTGCGGCGCACATAGACAAGCTGAAGCCGGCGAGCTCCGACGGCGAATGCGAAGAAGACAAGGC
CGCGCCCGTCGGCTGCGCTGACGGCACCAAGAGCTCGACCAACCCGTTCCTTATGGCCCTCCAGCTGAGCCCGCT
CGTCGTCTTCTGCCCGCTCCGGTACTCGTTCCAATGGGCCATCTTCATCGCGATGCTCAGCCAGAGCCACGCGTG
GCCGACGGCTGGGTCGCCGGTCGGCCTGCTGGCCAACTTAGTCTTCAGCATCATATTTGCGCGGGCCGTTCTTCG
GCTCGTCGCCCCTTTCTTCGGCATTGCTGCTAAGTGGCTCATCGTCGGTCGCTATGCCGAAGGCCTATATCCTAT
GTGGGGAGGCTATCATACTCGCTGGTGGTTAGTCCAGAAGATCGAGGCTATCTGCGGCAAGGGTATCTTTAATAT
TAATGACTCGACCCTTCGAATCTACTATATCTTAATGGGGGCCAGGATCGGCCGCCGTGTCCGGCTCCAAGGCGC
CGCTTTAGGCGAGTGGGATCTCTTGGATATCGGGGACGATGCCATCCTGGCAGGAGGCTGCGTATGCCGGCCGTT
TGCAGTTGAAGGGAATACGACGATGTATCTTGGCAGGATCAAGATTGGCGAGAAAAGCTCTATCAACGTCTCGTC
CGTCTTGGCCCCGGGCTCTGATATCCCTCCAAACACCCATATCGGCCCCAATTCGTCGAGCTGGGAGATGGCGGA
CGCAACGGAGGAAAACGGCGACCTGAACGCCCGCAAGGCATCCGGTCCGCACTGGCTGCTCACCGTCCTGCTTAC
GGCGCCGTTGCTCTCTGTGGCCTGGATCCTGTCGCTTCTCCCCTGGATTGCCGGACTGTTGGGCATGGTGCTTCC
GGGCAAGCATGTGGTCCCTTTCATGGTACGAGGCACGCTTGCCTGGTTCACGACGGACACGAGACTAGCGTTCCA
CTATCTCGCACTGGCCCTGAAAGTGATCGGTCCCTTTTTTCTGTTGGGCTTTGCCGTCTTGCTTCGCCTTCTCCT
CGACGGCCTCTTCGGGAAGCTTGAGTCGGGGTCTTCCCGAGGCCGAGGCGCGTGGGCAACGTGGCGCCAGTCCCT
GATGAAGACGCTGATGCCTATGCGGCAGCTGCAACAAGTTACGGCCATGTTCGGGAAGCATTATGAAGCTACATC
TATCGTCCTCCGGCTGCTCGGAAGCAGAATCGGAAAGCGTGTATATTGGCCCGGAACAGGTCCCTATATCGGGGA
CTACCATCTCCTCGATATTGGCGACGATGTCGTGTTCGGATCTCGCTCATACCTCCTCACCTCCGATGGTGTCGG
ATCGGATACGATTACTGTCCGCGATGGCGCCATGATTGCGGACCGTGTCTGCCTTCTGCCCGGGGCGGACGTTGG
CAGGCAGACGACCATGGGATCGGGTGCCCTGGGCCGCAAGGGGAAGAAGTATGACGACGGTGCGACCTATGTCGG
CTCGCAAGCCGGCGATGCCGTCCTCCTCTCTACCGGCCGTGACGGCGCCGAGAGGAGTCGGCGTTCACGGGCGCT
GGTAATGCCAGGCGAGAAGCCTAGTGACGATACCCTTGCCGAGACGGCGTCACCCTTCGGACGCGCCTTTTACTA
CAAGCTTGCCCCTTACTACGTCTTCAGCCCATCTCTCATCTTCTTCTACTCGGTACTGACAACTGTCCTTGCCGT
TCTCTACTGGAACCTTCCGATTATCTGCTCAACACAGATCGCTCACACTCTCATGAGCCGGTACATCCCAGTCCT
GGGCTTCTGGGCTGAAGTGGCGACCACCCTGGGCATCATATTCCCACTGACCGCCATCCTCATGACGATCCAGGC
CGTGGTAGCCCTGATGATCGTCATCGCGGCGAAATGGAGCCTGCTGGGGCGTCGCCAGCCGGGCAACTACGATTG
GGACAAGTCTTCCTACTGCCAGCGGTGGCAGCTATTCCTAGCCATCGAGAAAATCCGCCAAGTTAGCTTTAGCGG
ACAGGGCATACTAGGACTTCTGACCGGCACGCACTGGATGGTGCTGTACTTCCGGGCCATGGGCGCTACGATCGG
AGATGATTGCGCCCTATTTGCTAATGGCTGCCCGAGTGTTATGTTCACCGAGCCCGACCTGATTTCTTTAGGCAG
TCGTGTGGCCGTCGACGACGCGAGCATCGTGGCCCATGTCAATACGCGGGGAACATTTAACCTCAATAGGATAGA
AGTCGGGAATAGGTGCGTGCTGCGGACGGGCAGTCGTCTGCTAAGTGGTGCTACTATGAAAGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail