Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8056
Gene name
LocationContig_501:14407..17440
Strand+
Gene length (bp)3033
Transcript length (bp)2973
Coding sequence length (bp)2973
Protein length (aa) 991

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06833|YP091_YEAST Uncharacterized PH domain-containing protein YPR091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR091C PE=1 SV=1 30 519 2.0E-76
sp|O94464|YBR6_SCHPO Uncharacterized protein C23G7.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23G7.06c PE=1 SV=3 33 516 3.0E-56
sp|Q8IWB9|TEX2_HUMAN Testis-expressed sequence 2 protein OS=Homo sapiens GN=TEX2 PE=1 SV=2 423 500 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8056
LAESRLSRPADGSDPSLSPAPLAFDAPTVMGSWTAILVAYLVGGITFLPLLVVVVLAHAHYAFPYRHDVASAPTR
DDDGNIVQPGDDTAPLQASKKSAAAESKTRANQDLDVAAGYFAVCREYTPMGINAKPIERSTPVGSATVASPSPS
VYQTMYRSIFDRKPASAAPEINGLSQRPKKAGNVFYVVLRHGHLMLFDDDEQLEVRHVISLAHHDISIYSGGDAT
PEGELFIKRNALCLSRRRGGPDETPDNPVSKPFYLFSENCSAKEDFYFALLKNQEQTFGFDASAPKPKHFDVKSI
IALVQRLHSSEDHLHSRWLNALLGRLFLAVYKTRDLENFLRDKITNKISRVKRPSFLTNITIQGIDTGEAAPYFT
NLKLRDLTVEGECVVEADVRYNGNFRIQVGATAKIDLGARFKAREVNLVLAVLLKRVEGHVLFKIKAPPTNRLWF
SFQTMPKMEMAIEPIVSSRQITYTVILRQIENRIKEVFAETLVQPFWDDVPFFRTENKRWRGGIFEGDDALESSG
AAEAAGDELSGNAPLAADRLDENPQILNETRPLEKCQSLPVLDPQPEKTGLFGRKLGKNANGSTTSVASTGTDVK
GAGATSPLRSPHILKNSTDPIVSTETTHADLFKPSSSPPDHATNYMAALQSRSQDASPMNTPTSSPFKPRAVAKR
PSQTSMLSGKDAGEREKNDETNMEPVRPGRRGTASSAGSSSNSDASNTNSPTHSSAASSLKNQPGTLGRNFFLRR
ENSNNTIGTESSAGEAKRGTLAAVTNAAAQARQWGWNALQRQKDARRGGEKVTQVDLSQPMGRGQPLPPPGVPLP
GPTNGSTKLVPISAPRRKPTMEQEPQATGKEREPLPVPQNRRRGASQDQAGDGEPNILVVEAPDDSQPGTPLTED
KMESEASWPAASTAPEAAALGTTPESSNGTREPSLLDVKPMPRGPLVALPATASLDDEDDDYSGWIEDDVLDGTQ
IGDDMAATVVAGEVR*
Coding >Hirsu2|8056
CTGGCCGAGTCTCGACTTTCGCGCCCGGCCGACGGCTCGGACCCCTCCCTCTCTCCCGCACCGCTGGCCTTCGAC
GCCCCGACGGTCATGGGTAGTTGGACGGCGATCCTCGTGGCCTACCTCGTCGGCGGCATCACCTTCCTCCCTCTG
CTCGTCGTCGTCGTGCTTGCCCACGCCCACTACGCCTTTCCATACCGCCACGATGTCGCCTCCGCCCCGACCCGA
GACGATGACGGCAACATCGTCCAGCCCGGAGACGACACGGCCCCGCTCCAGGCGAGCAAGAAATCCGCCGCCGCC
GAGTCCAAGACGCGTGCCAACCAAGACCTCGACGTGGCTGCCGGCTACTTTGCCGTCTGCCGCGAGTACACGCCC
ATGGGCATCAACGCCAAGCCCATCGAGCGCTCCACCCCCGTCGGCTCTGCCACCGTCGCCTCGCCCAGTCCCAGC
GTCTACCAGACCATGTACCGGAGCATCTTCGACCGGAAACCGGCCTCGGCCGCCCCGGAGATCAATGGACTGAGC
CAGCGGCCCAAGAAGGCCGGCAACGTCTTCTACGTCGTGCTCCGCCACGGCCACCTCATGCTCTTCGACGACGAC
GAGCAGCTCGAAGTGCGCCACGTCATATCCCTCGCGCACCACGACATCAGCATCTACTCGGGCGGAGACGCGACC
CCCGAGGGCGAGCTGTTCATCAAGCGCAACGCCCTGTGCCTGTCCCGCAGGCGCGGCGGCCCGGACGAGACGCCC
GACAACCCCGTCTCCAAGCCCTTCTACCTCTTCTCCGAGAACTGCTCTGCCAAGGAGGACTTCTACTTTGCCCTG
CTCAAGAACCAAGAGCAGACCTTTGGCTTCGACGCCTCGGCCCCTAAGCCCAAGCACTTTGATGTCAAGAGCATC
ATCGCCCTTGTCCAGCGCCTGCACTCCTCCGAGGACCACCTCCACTCCCGCTGGCTCAACGCCCTGCTCGGCCGT
CTCTTTCTCGCCGTCTACAAGACGCGCGACCTCGAGAATTTCCTCCGCGACAAGATCACCAACAAGATCTCCCGC
GTCAAGCGGCCCTCCTTCCTCACCAACATCACCATCCAGGGCATCGACACGGGCGAGGCGGCCCCCTACTTCACC
AACCTCAAGCTCAGGGACCTGACCGTCGAGGGCGAGTGCGTCGTCGAGGCCGACGTCAGGTACAACGGCAACTTC
CGCATCCAGGTCGGCGCCACCGCCAAGATCGACCTGGGCGCCAGGTTCAAGGCCCGCGAGGTCAACCTGGTCCTG
GCCGTGCTGCTCAAGCGCGTCGAGGGCCACGTCCTCTTCAAGATCAAGGCGCCCCCCACCAACCGCCTCTGGTTC
TCCTTCCAGACCATGCCCAAGATGGAGATGGCCATCGAGCCCATCGTGAGCTCGAGGCAGATCACCTACACCGTC
ATCCTGCGCCAGATCGAGAACCGCATCAAGGAAGTCTTCGCCGAGACCTTGGTCCAGCCCTTCTGGGACGACGTC
CCCTTCTTCCGCACCGAGAACAAGCGGTGGAGGGGGGGCATTTTCGAGGGAGATGACGCCCTCGAGTCGTCCGGG
GCGGCCGAGGCCGCGGGAGACGAGCTGTCCGGCAACGCCCCCCTCGCGGCCGACCGTCTCGACGAGAACCCCCAG
ATTCTCAACGAGACCCGCCCCCTGGAGAAGTGCCAGAGCCTCCCTGTGCTGGATCCGCAGCCGGAGAAGACGGGC
CTCTTCGGCAGGAAGCTGGGCAAGAACGCGAACGGCAGCACGACGTCGGTCGCCTCGACGGGCACCGACGTCAAG
GGCGCCGGGGCCACCAGCCCCCTGCGATCGCCGCACATCCTCAAGAATTCGACGGACCCCATCGTCAGCACAGAG
ACGACGCACGCCGACCTCTTCAAGCCGTCATCCTCGCCTCCCGACCACGCCACAAACTACATGGCCGCGTTGCAG
TCGCGGTCCCAAGACGCCTCGCCCATGAACACGCCCACGTCGTCGCCGTTCAAGCCGAGGGCAGTGGCCAAACGA
CCGAGTCAGACGTCGATGCTGTCTGGCAAGGATGCCGGGGAACGAGAGAAGAATGACGAGACCAACATGGAGCCT
GTACGGCCCGGCCGACGCGGCACCGCGTCGTCTGCCGGATCCAGCTCGAACAGCGACGCCTCCAACACCAACTCC
CCCACGCACTCCTCCGCCGCCAGCTCGCTGAAGAACCAGCCAGGGACCCTGGGTCGCAACTTCTTCCTTCGCCGC
GAGAATTCCAACAACACGATCGGCACCGAGTCCTCTGCCGGAGAAGCCAAGAGGGGCACACTGGCGGCCGTGACC
AACGCCGCGGCGCAGGCTCGGCAGTGGGGCTGGAACGCGCTCCAGCGGCAGAAGGACGCCCGGCGCGGCGGCGAA
AAGGTGACGCAGGTCGACCTCAGCCAGCCTATGGGACGGGGCCAGCCGCTGCCGCCGCCAGGCGTGCCGCTGCCG
GGTCCCACCAACGGCAGCACGAAGCTGGTGCCGATATCCGCGCCGAGGCGCAAGCCCACGATGGAGCAGGAGCCT
CAGGCGACGGGCAAGGAGCGCGAGCCCCTCCCCGTGCCGCAGAACAGGAGACGCGGCGCGAGCCAGGACCAGGCC
GGAGACGGCGAGCCGAACATACTGGTCGTCGAGGCGCCGGACGACTCGCAGCCCGGGACGCCGCTGACGGAGGAC
AAGATGGAGAGCGAGGCCTCGTGGCCGGCCGCCTCGACGGCGCCCGAGGCGGCGGCACTGGGGACGACGCCGGAG
TCGTCGAACGGAACGCGGGAGCCGTCGCTGCTGGACGTCAAGCCGATGCCGCGAGGTCCTCTGGTGGCGTTGCCC
GCGACGGCGAGCCTCGACGACGAAGACGATGACTACTCGGGCTGGATCGAGGACGACGTGCTGGACGGAACGCAG
ATTGGCGACGACATGGCCGCCACGGTCGTTGCGGGCGAGGTCCGATGA
Transcript >Hirsu2|8056
CTGGCCGAGTCTCGACTTTCGCGCCCGGCCGACGGCTCGGACCCCTCCCTCTCTCCCGCACCGCTGGCCTTCGAC
GCCCCGACGGTCATGGGTAGTTGGACGGCGATCCTCGTGGCCTACCTCGTCGGCGGCATCACCTTCCTCCCTCTG
CTCGTCGTCGTCGTGCTTGCCCACGCCCACTACGCCTTTCCATACCGCCACGATGTCGCCTCCGCCCCGACCCGA
GACGATGACGGCAACATCGTCCAGCCCGGAGACGACACGGCCCCGCTCCAGGCGAGCAAGAAATCCGCCGCCGCC
GAGTCCAAGACGCGTGCCAACCAAGACCTCGACGTGGCTGCCGGCTACTTTGCCGTCTGCCGCGAGTACACGCCC
ATGGGCATCAACGCCAAGCCCATCGAGCGCTCCACCCCCGTCGGCTCTGCCACCGTCGCCTCGCCCAGTCCCAGC
GTCTACCAGACCATGTACCGGAGCATCTTCGACCGGAAACCGGCCTCGGCCGCCCCGGAGATCAATGGACTGAGC
CAGCGGCCCAAGAAGGCCGGCAACGTCTTCTACGTCGTGCTCCGCCACGGCCACCTCATGCTCTTCGACGACGAC
GAGCAGCTCGAAGTGCGCCACGTCATATCCCTCGCGCACCACGACATCAGCATCTACTCGGGCGGAGACGCGACC
CCCGAGGGCGAGCTGTTCATCAAGCGCAACGCCCTGTGCCTGTCCCGCAGGCGCGGCGGCCCGGACGAGACGCCC
GACAACCCCGTCTCCAAGCCCTTCTACCTCTTCTCCGAGAACTGCTCTGCCAAGGAGGACTTCTACTTTGCCCTG
CTCAAGAACCAAGAGCAGACCTTTGGCTTCGACGCCTCGGCCCCTAAGCCCAAGCACTTTGATGTCAAGAGCATC
ATCGCCCTTGTCCAGCGCCTGCACTCCTCCGAGGACCACCTCCACTCCCGCTGGCTCAACGCCCTGCTCGGCCGT
CTCTTTCTCGCCGTCTACAAGACGCGCGACCTCGAGAATTTCCTCCGCGACAAGATCACCAACAAGATCTCCCGC
GTCAAGCGGCCCTCCTTCCTCACCAACATCACCATCCAGGGCATCGACACGGGCGAGGCGGCCCCCTACTTCACC
AACCTCAAGCTCAGGGACCTGACCGTCGAGGGCGAGTGCGTCGTCGAGGCCGACGTCAGGTACAACGGCAACTTC
CGCATCCAGGTCGGCGCCACCGCCAAGATCGACCTGGGCGCCAGGTTCAAGGCCCGCGAGGTCAACCTGGTCCTG
GCCGTGCTGCTCAAGCGCGTCGAGGGCCACGTCCTCTTCAAGATCAAGGCGCCCCCCACCAACCGCCTCTGGTTC
TCCTTCCAGACCATGCCCAAGATGGAGATGGCCATCGAGCCCATCGTGAGCTCGAGGCAGATCACCTACACCGTC
ATCCTGCGCCAGATCGAGAACCGCATCAAGGAAGTCTTCGCCGAGACCTTGGTCCAGCCCTTCTGGGACGACGTC
CCCTTCTTCCGCACCGAGAACAAGCGGTGGAGGGGGGGCATTTTCGAGGGAGATGACGCCCTCGAGTCGTCCGGG
GCGGCCGAGGCCGCGGGAGACGAGCTGTCCGGCAACGCCCCCCTCGCGGCCGACCGTCTCGACGAGAACCCCCAG
ATTCTCAACGAGACCCGCCCCCTGGAGAAGTGCCAGAGCCTCCCTGTGCTGGATCCGCAGCCGGAGAAGACGGGC
CTCTTCGGCAGGAAGCTGGGCAAGAACGCGAACGGCAGCACGACGTCGGTCGCCTCGACGGGCACCGACGTCAAG
GGCGCCGGGGCCACCAGCCCCCTGCGATCGCCGCACATCCTCAAGAATTCGACGGACCCCATCGTCAGCACAGAG
ACGACGCACGCCGACCTCTTCAAGCCGTCATCCTCGCCTCCCGACCACGCCACAAACTACATGGCCGCGTTGCAG
TCGCGGTCCCAAGACGCCTCGCCCATGAACACGCCCACGTCGTCGCCGTTCAAGCCGAGGGCAGTGGCCAAACGA
CCGAGTCAGACGTCGATGCTGTCTGGCAAGGATGCCGGGGAACGAGAGAAGAATGACGAGACCAACATGGAGCCT
GTACGGCCCGGCCGACGCGGCACCGCGTCGTCTGCCGGATCCAGCTCGAACAGCGACGCCTCCAACACCAACTCC
CCCACGCACTCCTCCGCCGCCAGCTCGCTGAAGAACCAGCCAGGGACCCTGGGTCGCAACTTCTTCCTTCGCCGC
GAGAATTCCAACAACACGATCGGCACCGAGTCCTCTGCCGGAGAAGCCAAGAGGGGCACACTGGCGGCCGTGACC
AACGCCGCGGCGCAGGCTCGGCAGTGGGGCTGGAACGCGCTCCAGCGGCAGAAGGACGCCCGGCGCGGCGGCGAA
AAGGTGACGCAGGTCGACCTCAGCCAGCCTATGGGACGGGGCCAGCCGCTGCCGCCGCCAGGCGTGCCGCTGCCG
GGTCCCACCAACGGCAGCACGAAGCTGGTGCCGATATCCGCGCCGAGGCGCAAGCCCACGATGGAGCAGGAGCCT
CAGGCGACGGGCAAGGAGCGCGAGCCCCTCCCCGTGCCGCAGAACAGGAGACGCGGCGCGAGCCAGGACCAGGCC
GGAGACGGCGAGCCGAACATACTGGTCGTCGAGGCGCCGGACGACTCGCAGCCCGGGACGCCGCTGACGGAGGAC
AAGATGGAGAGCGAGGCCTCGTGGCCGGCCGCCTCGACGGCGCCCGAGGCGGCGGCACTGGGGACGACGCCGGAG
TCGTCGAACGGAACGCGGGAGCCGTCGCTGCTGGACGTCAAGCCGATGCCGCGAGGTCCTCTGGTGGCGTTGCCC
GCGACGGCGAGCCTCGACGACGAAGACGATGACTACTCGGGCTGGATCGAGGACGACGTGCTGGACGGAACGCAG
ATTGGCGACGACATGGCCGCCACGGTCGTTGCGGGCGAGGTCCGATGA
Gene >Hirsu2|8056
CTGGCCGAGTCTCGACTTTCGCGCCCGGCCGACGGCTCGGACCCCTCCCTCTCTCCCGCACCGCTGGCCTTCGAC
GCCCCGACGGTCATGGGTAGTTGGACGGCGATCCTCGTGGCCTACCTCGTCGGCGGCATCACCTTCCTCCCTCTG
CTCGTCGTCGTCGTGCTTGCCCACGCCCACTACGCCTTTCCATACCGCCACGATGTCGCCTCCGCCCCGACCCGA
GACGATGACGGCAACATCGTCCAGCCCGGAGACGACACGGCCCCGCTCCAGGCGAGCAAGAAATCCGCCGCCGCC
GAGTCCAAGACGCGTGCCAACCAAGACCTCGACGTGGCTGCCGGCTACTTTGCCGTCTGCCGCGAGTACACGCCC
ATGGGCATCAACGCCAAGCCCATCGAGCGCTCCACCCCCGTCGGCTCTGCCACCGTCGCCTCGCCCAGTCCCAGC
GTCTACCAGACCATGTACCGGAGCATCTTCGACCGGAAACCGGCCTCGGCCGCCCCGGAGATCAATGGACTGAGC
CAGCGGCCCAAGAAGGCCGGCAACGTCTTCTACGTCGTGCTCCGGTGAGTCGCCCTCGTCTCTCCCCCGTCGTCT
TGGGCATATCGCGCTGACGCACCCCCGAGCCACGGCCACCTCATGCTCTTCGACGACGACGAGCAGCTCGAAGTG
CGCCACGTCATATCCCTCGCGCACCACGACATCAGCATCTACTCGGGCGGAGACGCGACCCCCGAGGGCGAGCTG
TTCATCAAGCGCAACGCCCTGTGCCTGTCCCGCAGGCGCGGCGGCCCGGACGAGACGCCCGACAACCCCGTCTCC
AAGCCCTTCTACCTCTTCTCCGAGAACTGCTCTGCCAAGGAGGACTTCTACTTTGCCCTGCTCAAGAACCAAGAG
CAGACCTTTGGCTTCGACGCCTCGGCCCCTAAGCCCAAGCACTTTGATGTCAAGAGCATCATCGCCCTTGTCCAG
CGCCTGCACTCCTCCGAGGACCACCTCCACTCCCGCTGGCTCAACGCCCTGCTCGGCCGTCTCTTTCTCGCCGTC
TACAAGACGCGCGACCTCGAGAATTTCCTCCGCGACAAGATCACCAACAAGATCTCCCGCGTCAAGCGGCCCTCC
TTCCTCACCAACATCACCATCCAGGGCATCGACACGGGCGAGGCGGCCCCCTACTTCACCAACCTCAAGCTCAGG
GACCTGACCGTCGAGGGCGAGTGCGTCGTCGAGGCCGACGTCAGGTACAACGGCAACTTCCGCATCCAGGTCGGC
GCCACCGCCAAGATCGACCTGGGCGCCAGGTTCAAGGCCCGCGAGGTCAACCTGGTCCTGGCCGTGCTGCTCAAG
CGCGTCGAGGGCCACGTCCTCTTCAAGATCAAGGCGCCCCCCACCAACCGCCTCTGGTTCTCCTTCCAGACCATG
CCCAAGATGGAGATGGCCATCGAGCCCATCGTGAGCTCGAGGCAGATCACCTACACCGTCATCCTGCGCCAGATC
GAGAACCGCATCAAGGAAGTCTTCGCCGAGACCTTGGTCCAGCCCTTCTGGGACGACGTCCCCTTCTTCCGCACC
GAGAACAAGCGGTGGAGGGGGGGCATTTTCGAGGGAGATGACGCCCTCGAGTCGTCCGGGGCGGCCGAGGCCGCG
GGAGACGAGCTGTCCGGCAACGCCCCCCTCGCGGCCGACCGTCTCGACGAGAACCCCCAGATTCTCAACGAGACC
CGCCCCCTGGAGAAGTGCCAGAGCCTCCCTGTGCTGGATCCGCAGCCGGAGAAGACGGGCCTCTTCGGCAGGAAG
CTGGGCAAGAACGCGAACGGCAGCACGACGTCGGTCGCCTCGACGGGCACCGACGTCAAGGGCGCCGGGGCCACC
AGCCCCCTGCGATCGCCGCACATCCTCAAGAATTCGACGGACCCCATCGTCAGCACAGAGACGACGCACGCCGAC
CTCTTCAAGCCGTCATCCTCGCCTCCCGACCACGCCACAAACTACATGGCCGCGTTGCAGTCGCGGTCCCAAGAC
GCCTCGCCCATGAACACGCCCACGTCGTCGCCGTTCAAGCCGAGGGCAGTGGCCAAACGACCGAGTCAGACGTCG
ATGCTGTCTGGCAAGGATGCCGGGGAACGAGAGAAGAATGACGAGACCAACATGGAGCCTGTACGGCCCGGCCGA
CGCGGCACCGCGTCGTCTGCCGGATCCAGCTCGAACAGCGACGCCTCCAACACCAACTCCCCCACGCACTCCTCC
GCCGCCAGCTCGCTGAAGAACCAGCCAGGGACCCTGGGTCGCAACTTCTTCCTTCGCCGCGAGAATTCCAACAAC
ACGATCGGCACCGAGTCCTCTGCCGGAGAAGCCAAGAGGGGCACACTGGCGGCCGTGACCAACGCCGCGGCGCAG
GCTCGGCAGTGGGGCTGGAACGCGCTCCAGCGGCAGAAGGACGCCCGGCGCGGCGGCGAAAAGGTGACGCAGGTC
GACCTCAGCCAGCCTATGGGACGGGGCCAGCCGCTGCCGCCGCCAGGCGTGCCGCTGCCGGGTCCCACCAACGGC
AGCACGAAGCTGGTGCCGATATCCGCGCCGAGGCGCAAGCCCACGATGGAGCAGGAGCCTCAGGCGACGGGCAAG
GAGCGCGAGCCCCTCCCCGTGCCGCAGAACAGGAGACGCGGCGCGAGCCAGGACCAGGCCGGAGACGGCGAGCCG
AACATACTGGTCGTCGAGGCGCCGGACGACTCGCAGCCCGGGACGCCGCTGACGGAGGACAAGATGGAGAGCGAG
GCCTCGTGGCCGGCCGCCTCGACGGCGCCCGAGGCGGCGGCACTGGGGACGACGCCGGAGTCGTCGAACGGAACG
CGGGAGCCGTCGCTGCTGGACGTCAAGCCGATGCCGCGAGGTCCTCTGGTGGCGTTGCCCGCGACGGCGAGCCTC
GACGACGAAGACGATGACTACTCGGGCTGGATCGAGGACGACGTGCTGGACGGAACGCAGATTGGCGACGACATG
GCCGCCACGGTCGTTGCGGGCGAGGTCCGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail