Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8054
Gene name
LocationContig_501:5986..11228
Strand+
Gene length (bp)5242
Transcript length (bp)5112
Coding sequence length (bp)5112
Protein length (aa) 1704

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12814 Mcp5_PH Meiotic cell cortex C-terminal pleckstrin homology 1.7E-45 1391 1508
PF00169 PH PH domain 1.4E-05 1402 1507

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q00083|APSA_EMENI Anucleate primary sterigmata protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=apsA PE=1 SV=2 22 1686 0.0E+00
sp|Q00402|NUM1_YEAST Nuclear migration protein NUM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUM1 PE=1 SV=2 1353 1512 2.0E-31
sp|Q9Y7J9|MCP5_SCHPO Meiotic coiled-coil protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcp5 PE=1 SV=1 1299 1503 5.0E-06

GO

GO Term Description Terminal node
GO:0032065 cortical protein anchoring Yes
GO:0005938 cell cortex Yes
GO:0005515 protein binding Yes
GO:0005543 phospholipid binding Yes
GO:0065008 regulation of biological quality No
GO:0005575 cellular_component No
GO:0099568 cytoplasmic region No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0051235 maintenance of location No
GO:0065007 biological regulation No
GO:0032507 maintenance of protein location in cell No
GO:0005737 cytoplasm No
GO:0045185 maintenance of protein location No
GO:0051179 localization No
GO:0044464 cell part No
GO:0044444 cytoplasmic part No
GO:0008289 lipid binding No
GO:0043168 anion binding No
GO:0044424 intracellular part No
GO:0051651 maintenance of location in cell No
GO:0043167 ion binding No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8054
MASSLAPDGRPSLPVPGEGATDPFVAVAASASSASTHHRFSDFDQELFAAGPASSPTQAKRALEAHLADTDYRLD
EVGKLGTALVSQRKALAAQLDELGKLQAEGNIGPDLRKKLVDIEKEYNDVARESARVFLPKQRVPSNETNPGSPY
VPESRGGRRSVSPSKFESQATGSPTKLNVPSRKSRNQPSNRVHDIEFAAEISTSLIAQVRNLQTLLSERDEEVKT
LHAERSKLEIESEGLQQRLRTLDESEHRYKEENWNLETRLQELSSQQREAADREKRLAQALGISNTEKTAAQKEL
DEVKLSHSKLAEEHAAAVKHHDIELGTAKRSMVMAEGERAALQRKIDDLTGQNQELAKAFSLQRGRGAEREHAAG
NSDDDFETAADNMTPEHSPPPSPIKSTPRHSMLETETVKTSLQHAQRTIQSQRNLLHREKTEKLELRRIIQDLRD
DLEKTRNDAAGLTFNRRSRKADSRDMKKPPRLLGSFRSSRQEIVVDDDPEWEDNPDVSPRVNTAPAQAAATVLPS
IEARDDFETANEASESAFETANERATETEDFQTGHEELSGSDTETETETPSRGFGRMKRPPSLPSGLARQRSRGS
FDSTASTSADEQDLPEVKTPTKSLTSQRSRMRIGRGTFSRSRQASEEPNLRSSPSSYASGGTPHAGQSLFTELRD
MGGSDEEESGAGTPSRRSLRSATPGSIRRTLSPPPAVPRLPRVIMVDSGAMTDPVKITDDVFEEVAERPVSMESV
VNAPLVHPLTAWRGSHGAGTDSSRPLSTGSGSHGDAGAQYEQDIGDKLAQFPVPPSSAPVARPPTPPSLGFSPIQ
SLHVEPRAEVQTPPTPPALCFTPLAMQHVEPRPDPGSPAPVLSLSTIVSEGSEPVAEPDVPRAELTMTPVLAQAV
EPIATPPPSLTLSVISAEAVEPVAEPEPMMTVPRLATPALPTLNLSNIMSETIEPVREPAIIVTSPSLTFSTIRV
QELEPREEPVLTQPQPPLAFSHIMAEHVHPVSEPEPVWPTLSLSSIAAQDTSPIIPPLPSPPTLAMSSIASEHVE
PAGSPLLETPSLPNFGFSTIESIETRPISPRSPRRDGFILPRDDHVRDGSNPLETPSGTRALGLALGRGKKDDFV
PMIAEDETRQSPRDSPDVGTPESQRPFKEISSNSISRSPRRQREPMSDQSAQTSLTSQAIDKLLKSGPQSAGSHL
YHTSMSSFGSPNTTGTVRIHRSQESLDSPVRGTAMDASASEADGLTFRPGSATSVVSGKGSTTNQDMPPPLPPNH
RQMINAARSNSSRSLLGTMGPPLWPASALKQQRPRTPNEQRPTSAASARATPTPRAVRAGSAHGTAEIHSPTKLT
VRSRQSSVSSFASELDCRFNMRAGEMGIDPTGLSPSTDPRMIQAITQTMIGEFLWKYTRKTGRGEMSENRHRRYF
WVHPYTRTLYWSNQDPSSAGRTELKAKSVPIEGVRVMDDHNPMPPGLHRKSLLIISPGRTIKFTCTTGQRHETWF
NALSYLLKRTNQDSQSDVEEVAETMARDEVEEFNPQFGRRGANGNRAGGVAPSLSSYHSRTTRNDGPADGLSLDI
PTLTPANNRQSTATRASAGTLGKLSGYWKAAPKLSGTFSSLRGRGPASQSVEVYEASVVHDSAEDLREMMERQDR
ESDRLENVRACCDGKHDVGTLNHVPRRGRSQLSHSHPGPVMSNAALAASRSRT*
Coding >Hirsu2|8054
ATGGCTTCGTCCCTGGCCCCGGACGGCCGCCCGAGCCTCCCCGTGCCTGGGGAGGGCGCAACGGACCCGTTTGTC
GCTGTCGCCGCTTCCGCCTCCTCCGCGTCGACGCACCATCGCTTCTCCGACTTCGACCAGGAGCTCTTCGCCGCC
GGCCCTGCCTCGTCTCCAACGCAGGCCAAACGCGCACTCGAGGCTCACCTCGCGGACACCGACTACCGCCTCGAT
GAAGTCGGCAAGCTGGGCACCGCGCTCGTCTCCCAGCGTAAGGCGCTGGCCGCGCAGCTGGACGAGCTGGGCAAG
CTGCAGGCCGAGGGAAACATAGGGCCCGACTTGCGCAAGAAGCTTGTCGACATCGAGAAGGAGTACAACGATGTC
GCCCGCGAGTCGGCCCGCGTTTTCCTGCCCAAGCAGCGCGTGCCCAGCAACGAGACCAATCCTGGCTCCCCCTAC
GTCCCTGAGAGCCGAGGAGGCAGACGATCCGTGAGCCCTTCCAAGTTCGAAAGCCAAGCCACCGGCTCTCCCACC
AAGCTCAACGTCCCGAGCCGCAAAAGCCGCAACCAGCCGTCCAATCGCGTCCACGACATCGAGTTTGCCGCCGAG
ATCAGCACCTCGCTCATTGCTCAAGTCCGCAATCTGCAGACCCTGCTCTCCGAGCGGGACGAGGAGGTCAAGACC
CTGCACGCCGAGAGGTCCAAGCTCGAAATCGAGTCCGAGGGTCTGCAGCAGCGGCTGAGGACCCTTGACGAGAGC
GAGCACCGCTACAAGGAGGAAAACTGGAACCTCGAGACTCGTCTGCAGGAGCTTTCGTCGCAGCAGAGGGAAGCC
GCCGATCGGGAGAAGAGGCTTGCCCAGGCGCTCGGCATCTCCAACACCGAGAAGACGGCCGCCCAGAAGGAGCTG
GACGAGGTCAAGCTCTCCCACTCCAAGCTTGCCGAGGAGCATGCCGCCGCCGTCAAGCACCATGACATCGAACTC
GGCACCGCCAAGCGCTCCATGGTCATGGCCGAGGGCGAACGGGCTGCTCTGCAGCGCAAGATCGACGACCTGACC
GGCCAGAACCAGGAGCTTGCCAAGGCCTTCTCTCTGCAGCGAGGCAGAGGCGCCGAGCGCGAGCACGCCGCGGGC
AACAGCGATGACGACTTCGAGACGGCCGCCGACAACATGACCCCCGAACACTCGCCGCCGCCGTCGCCCATCAAG
AGCACGCCCAGACACTCCATGCTGGAGACGGAGACGGTCAAGACGTCGCTGCAGCACGCCCAGCGCACCATCCAG
AGCCAGCGCAACCTGCTCCACCGTGAGAAGACGGAGAAGCTCGAGCTGCGACGCATCATCCAGGACCTCCGTGAC
GACCTGGAGAAGACCCGGAACGATGCCGCCGGCCTCACGTTCAACCGGCGGAGCCGCAAGGCTGACTCCAGGGAC
ATGAAGAAGCCTCCGCGCTTGCTCGGCAGCTTCCGGTCGAGCCGCCAAGAAATCGTTGTCGACGACGACCCGGAA
TGGGAGGACAACCCCGACGTGTCGCCCCGAGTCAACACCGCCCCCGCCCAGGCCGCCGCGACCGTCCTCCCTTCG
ATCGAGGCACGCGACGACTTCGAGACGGCCAACGAGGCGAGCGAGTCGGCCTTCGAGACGGCCAACGAGCGGGCC
ACGGAGACGGAAGACTTCCAGACGGGCCACGAAGAGCTCTCGGGCAGCGATACCGAGACCGAGACCGAGACCCCA
TCCCGGGGCTTCGGTCGGATGAAGCGTCCCCCGAGCCTGCCGTCTGGTCTTGCCCGCCAAAGGAGTCGAGGTTCG
TTCGACAGCACCGCGTCGACGTCGGCCGATGAGCAGGACCTTCCGGAGGTCAAGACGCCCACGAAGTCGCTGACA
TCGCAACGAAGCCGAATGCGCATCGGCCGCGGCACCTTTTCGCGCAGCAGGCAGGCCAGCGAGGAGCCCAACCTG
CGAAGCAGTCCCTCGAGCTACGCCAGCGGAGGGACCCCCCATGCCGGCCAGAGCCTCTTCACCGAGCTGCGCGAC
ATGGGTGGCAGCGATGAGGAGGAGTCTGGCGCCGGGACGCCCAGTCGCAGGAGTCTGCGCTCTGCAACCCCAGGC
TCAATCCGTCGCACTCTGTCGCCCCCGCCTGCCGTCCCCCGCCTGCCCAGAGTCATCATGGTCGATAGCGGCGCC
ATGACGGATCCCGTCAAGATCACTGACGACGTCTTCGAGGAGGTCGCTGAACGGCCCGTCTCCATGGAGTCTGTC
GTCAACGCGCCACTCGTCCACCCGTTGACGGCGTGGAGAGGCAGCCACGGTGCCGGCACGGACTCTTCACGTCCC
TTGTCGACTGGGTCGGGGTCACATGGCGACGCGGGCGCGCAATACGAACAGGATATCGGAGACAAGCTCGCGCAG
TTCCCCGTACCCCCGTCGTCCGCCCCTGTCGCGAGACCGCCGACCCCCCCAAGCCTGGGCTTCTCCCCCATCCAA
TCCCTGCACGTCGAGCCGCGGGCGGAAGTGCAGACACCGCCGACCCCCCCGGCCCTCTGCTTCACGCCTCTGGCC
ATGCAGCACGTCGAGCCGCGTCCCGATCCGGGCAGCCCTGCACCTGTCCTCTCCCTCTCGACCATTGTCTCCGAG
GGGTCGGAACCCGTGGCAGAGCCGGACGTGCCCCGCGCGGAGCTCACCATGACCCCCGTCCTCGCGCAGGCCGTC
GAGCCGATTGCTACACCGCCCCCCTCCCTGACCTTGTCTGTCATCTCCGCCGAGGCGGTAGAGCCAGTGGCAGAG
CCAGAGCCCATGATGACTGTGCCGCGGCTGGCCACCCCGGCCTTGCCGACGCTCAATTTGTCCAACATCATGTCG
GAGACGATCGAGCCTGTCAGAGAACCTGCAATCATCGTCACGTCGCCGTCGCTCACCTTTTCGACCATCCGAGTG
CAGGAGCTGGAACCGAGGGAGGAGCCGGTGCTGACCCAGCCCCAGCCGCCGTTGGCCTTCTCGCACATCATGGCC
GAACATGTTCACCCCGTGTCCGAGCCGGAGCCCGTATGGCCGACCCTGTCGCTGTCCTCCATCGCCGCCCAGGAC
ACCAGCCCTATCATACCGCCCCTCCCCTCTCCTCCGACCCTGGCAATGTCCTCGATTGCATCCGAACACGTCGAG
CCTGCGGGCTCTCCTCTACTAGAGACGCCTTCTCTGCCCAACTTTGGCTTCTCAACAATCGAGTCCATTGAGACG
CGACCGATCTCGCCGCGCAGCCCTAGGAGAGACGGCTTCATCCTTCCCCGAGACGATCACGTCCGTGACGGTTCC
AATCCGCTCGAGACTCCCTCGGGTACTAGGGCCCTGGGACTGGCGTTGGGCCGGGGCAAGAAGGACGACTTCGTA
CCCATGATCGCCGAAGACGAGACGCGCCAATCTCCGAGAGACAGCCCTGACGTGGGGACGCCCGAATCTCAGCGC
CCATTCAAGGAAATATCGAGCAACTCCATCTCTCGCTCACCGCGGAGGCAGCGCGAGCCGATGAGCGACCAAAGT
GCCCAGACCTCCTTGACCTCGCAAGCCATCGACAAGCTGCTCAAGAGCGGCCCGCAGTCGGCGGGTAGCCACCTT
TACCATACCTCGATGAGCTCGTTCGGCAGCCCCAACACCACGGGCACTGTCAGGATCCACCGATCGCAGGAGAGC
CTGGACAGCCCCGTTCGCGGCACTGCGATGGACGCGTCCGCATCCGAGGCGGATGGGCTAACCTTCCGACCGGGC
AGCGCCACCAGTGTCGTCAGCGGCAAGGGCTCGACGACAAATCAGGACATGCCCCCGCCGCTCCCGCCCAACCAC
CGACAGATGATCAATGCGGCGCGCTCGAATTCTTCGCGCAGCCTCCTGGGCACCATGGGGCCGCCGCTGTGGCCG
GCGTCGGCCCTGAAGCAGCAGCGGCCTCGCACCCCGAACGAGCAACGGCCGACGTCGGCCGCGTCGGCTCGCGCG
ACGCCGACTCCGCGGGCCGTCCGCGCCGGGTCCGCCCACGGGACCGCAGAGATACACTCACCGACAAAGCTCACG
GTGCGGTCGAGGCAGTCCTCTGTCTCGTCCTTCGCGTCCGAACTCGACTGCCGGTTCAACATGCGAGCTGGCGAG
ATGGGCATAGACCCGACGGGGTTGAGCCCCAGCACAGACCCGCGCATGATCCAGGCTATCACGCAAACCATGATC
GGAGAGTTCCTCTGGAAATACACGCGGAAGACGGGGCGCGGCGAGATGTCGGAAAACAGGCACAGGCGGTACTTT
TGGGTCCATCCCTACACCAGAACGCTGTACTGGAGCAACCAAGATCCCTCATCGGCCGGACGCACCGAGCTCAAG
GCCAAGAGCGTGCCGATCGAGGGCGTGCGCGTCATGGACGACCACAACCCCATGCCGCCAGGGCTGCACCGCAAA
AGTCTGCTCATCATCTCCCCCGGACGGACCATCAAGTTCACGTGCACGACGGGCCAGCGACACGAGACGTGGTTC
AACGCCCTTTCCTATCTGTTGAAACGGACCAACCAGGACAGCCAGTCGGACGTGGAGGAAGTGGCGGAGACGATG
GCTCGCGACGAGGTCGAAGAGTTCAACCCCCAGTTCGGCCGTCGAGGCGCCAACGGAAACCGGGCGGGAGGCGTG
GCGCCGTCCCTGTCGTCGTACCACTCGCGGACGACGCGCAACGACGGACCGGCCGACGGGCTATCGTTGGACATC
CCGACCCTGACGCCGGCCAACAACAGGCAGTCGACGGCGACGCGGGCTTCGGCCGGCACGCTGGGCAAGTTGAGC
GGGTACTGGAAGGCGGCGCCCAAGCTGTCGGGGACGTTTTCGAGCCTGCGCGGCCGAGGCCCGGCGAGCCAGAGC
GTGGAGGTGTACGAGGCGAGCGTGGTGCACGACAGCGCCGAGGATCTGCGGGAGATGATGGAGCGGCAGGATCGG
GAGTCGGACCGGCTGGAGAATGTGAGGGCGTGCTGCGACGGCAAACACGACGTCGGAACGCTGAACCATGTTCCG
CGAAGAGGCCGCAGCCAGCTTTCGCACTCCCATCCGGGACCGGTCATGTCGAACGCGGCGCTGGCGGCGTCTCGC
TCCCGAACATGA
Transcript >Hirsu2|8054
ATGGCTTCGTCCCTGGCCCCGGACGGCCGCCCGAGCCTCCCCGTGCCTGGGGAGGGCGCAACGGACCCGTTTGTC
GCTGTCGCCGCTTCCGCCTCCTCCGCGTCGACGCACCATCGCTTCTCCGACTTCGACCAGGAGCTCTTCGCCGCC
GGCCCTGCCTCGTCTCCAACGCAGGCCAAACGCGCACTCGAGGCTCACCTCGCGGACACCGACTACCGCCTCGAT
GAAGTCGGCAAGCTGGGCACCGCGCTCGTCTCCCAGCGTAAGGCGCTGGCCGCGCAGCTGGACGAGCTGGGCAAG
CTGCAGGCCGAGGGAAACATAGGGCCCGACTTGCGCAAGAAGCTTGTCGACATCGAGAAGGAGTACAACGATGTC
GCCCGCGAGTCGGCCCGCGTTTTCCTGCCCAAGCAGCGCGTGCCCAGCAACGAGACCAATCCTGGCTCCCCCTAC
GTCCCTGAGAGCCGAGGAGGCAGACGATCCGTGAGCCCTTCCAAGTTCGAAAGCCAAGCCACCGGCTCTCCCACC
AAGCTCAACGTCCCGAGCCGCAAAAGCCGCAACCAGCCGTCCAATCGCGTCCACGACATCGAGTTTGCCGCCGAG
ATCAGCACCTCGCTCATTGCTCAAGTCCGCAATCTGCAGACCCTGCTCTCCGAGCGGGACGAGGAGGTCAAGACC
CTGCACGCCGAGAGGTCCAAGCTCGAAATCGAGTCCGAGGGTCTGCAGCAGCGGCTGAGGACCCTTGACGAGAGC
GAGCACCGCTACAAGGAGGAAAACTGGAACCTCGAGACTCGTCTGCAGGAGCTTTCGTCGCAGCAGAGGGAAGCC
GCCGATCGGGAGAAGAGGCTTGCCCAGGCGCTCGGCATCTCCAACACCGAGAAGACGGCCGCCCAGAAGGAGCTG
GACGAGGTCAAGCTCTCCCACTCCAAGCTTGCCGAGGAGCATGCCGCCGCCGTCAAGCACCATGACATCGAACTC
GGCACCGCCAAGCGCTCCATGGTCATGGCCGAGGGCGAACGGGCTGCTCTGCAGCGCAAGATCGACGACCTGACC
GGCCAGAACCAGGAGCTTGCCAAGGCCTTCTCTCTGCAGCGAGGCAGAGGCGCCGAGCGCGAGCACGCCGCGGGC
AACAGCGATGACGACTTCGAGACGGCCGCCGACAACATGACCCCCGAACACTCGCCGCCGCCGTCGCCCATCAAG
AGCACGCCCAGACACTCCATGCTGGAGACGGAGACGGTCAAGACGTCGCTGCAGCACGCCCAGCGCACCATCCAG
AGCCAGCGCAACCTGCTCCACCGTGAGAAGACGGAGAAGCTCGAGCTGCGACGCATCATCCAGGACCTCCGTGAC
GACCTGGAGAAGACCCGGAACGATGCCGCCGGCCTCACGTTCAACCGGCGGAGCCGCAAGGCTGACTCCAGGGAC
ATGAAGAAGCCTCCGCGCTTGCTCGGCAGCTTCCGGTCGAGCCGCCAAGAAATCGTTGTCGACGACGACCCGGAA
TGGGAGGACAACCCCGACGTGTCGCCCCGAGTCAACACCGCCCCCGCCCAGGCCGCCGCGACCGTCCTCCCTTCG
ATCGAGGCACGCGACGACTTCGAGACGGCCAACGAGGCGAGCGAGTCGGCCTTCGAGACGGCCAACGAGCGGGCC
ACGGAGACGGAAGACTTCCAGACGGGCCACGAAGAGCTCTCGGGCAGCGATACCGAGACCGAGACCGAGACCCCA
TCCCGGGGCTTCGGTCGGATGAAGCGTCCCCCGAGCCTGCCGTCTGGTCTTGCCCGCCAAAGGAGTCGAGGTTCG
TTCGACAGCACCGCGTCGACGTCGGCCGATGAGCAGGACCTTCCGGAGGTCAAGACGCCCACGAAGTCGCTGACA
TCGCAACGAAGCCGAATGCGCATCGGCCGCGGCACCTTTTCGCGCAGCAGGCAGGCCAGCGAGGAGCCCAACCTG
CGAAGCAGTCCCTCGAGCTACGCCAGCGGAGGGACCCCCCATGCCGGCCAGAGCCTCTTCACCGAGCTGCGCGAC
ATGGGTGGCAGCGATGAGGAGGAGTCTGGCGCCGGGACGCCCAGTCGCAGGAGTCTGCGCTCTGCAACCCCAGGC
TCAATCCGTCGCACTCTGTCGCCCCCGCCTGCCGTCCCCCGCCTGCCCAGAGTCATCATGGTCGATAGCGGCGCC
ATGACGGATCCCGTCAAGATCACTGACGACGTCTTCGAGGAGGTCGCTGAACGGCCCGTCTCCATGGAGTCTGTC
GTCAACGCGCCACTCGTCCACCCGTTGACGGCGTGGAGAGGCAGCCACGGTGCCGGCACGGACTCTTCACGTCCC
TTGTCGACTGGGTCGGGGTCACATGGCGACGCGGGCGCGCAATACGAACAGGATATCGGAGACAAGCTCGCGCAG
TTCCCCGTACCCCCGTCGTCCGCCCCTGTCGCGAGACCGCCGACCCCCCCAAGCCTGGGCTTCTCCCCCATCCAA
TCCCTGCACGTCGAGCCGCGGGCGGAAGTGCAGACACCGCCGACCCCCCCGGCCCTCTGCTTCACGCCTCTGGCC
ATGCAGCACGTCGAGCCGCGTCCCGATCCGGGCAGCCCTGCACCTGTCCTCTCCCTCTCGACCATTGTCTCCGAG
GGGTCGGAACCCGTGGCAGAGCCGGACGTGCCCCGCGCGGAGCTCACCATGACCCCCGTCCTCGCGCAGGCCGTC
GAGCCGATTGCTACACCGCCCCCCTCCCTGACCTTGTCTGTCATCTCCGCCGAGGCGGTAGAGCCAGTGGCAGAG
CCAGAGCCCATGATGACTGTGCCGCGGCTGGCCACCCCGGCCTTGCCGACGCTCAATTTGTCCAACATCATGTCG
GAGACGATCGAGCCTGTCAGAGAACCTGCAATCATCGTCACGTCGCCGTCGCTCACCTTTTCGACCATCCGAGTG
CAGGAGCTGGAACCGAGGGAGGAGCCGGTGCTGACCCAGCCCCAGCCGCCGTTGGCCTTCTCGCACATCATGGCC
GAACATGTTCACCCCGTGTCCGAGCCGGAGCCCGTATGGCCGACCCTGTCGCTGTCCTCCATCGCCGCCCAGGAC
ACCAGCCCTATCATACCGCCCCTCCCCTCTCCTCCGACCCTGGCAATGTCCTCGATTGCATCCGAACACGTCGAG
CCTGCGGGCTCTCCTCTACTAGAGACGCCTTCTCTGCCCAACTTTGGCTTCTCAACAATCGAGTCCATTGAGACG
CGACCGATCTCGCCGCGCAGCCCTAGGAGAGACGGCTTCATCCTTCCCCGAGACGATCACGTCCGTGACGGTTCC
AATCCGCTCGAGACTCCCTCGGGTACTAGGGCCCTGGGACTGGCGTTGGGCCGGGGCAAGAAGGACGACTTCGTA
CCCATGATCGCCGAAGACGAGACGCGCCAATCTCCGAGAGACAGCCCTGACGTGGGGACGCCCGAATCTCAGCGC
CCATTCAAGGAAATATCGAGCAACTCCATCTCTCGCTCACCGCGGAGGCAGCGCGAGCCGATGAGCGACCAAAGT
GCCCAGACCTCCTTGACCTCGCAAGCCATCGACAAGCTGCTCAAGAGCGGCCCGCAGTCGGCGGGTAGCCACCTT
TACCATACCTCGATGAGCTCGTTCGGCAGCCCCAACACCACGGGCACTGTCAGGATCCACCGATCGCAGGAGAGC
CTGGACAGCCCCGTTCGCGGCACTGCGATGGACGCGTCCGCATCCGAGGCGGATGGGCTAACCTTCCGACCGGGC
AGCGCCACCAGTGTCGTCAGCGGCAAGGGCTCGACGACAAATCAGGACATGCCCCCGCCGCTCCCGCCCAACCAC
CGACAGATGATCAATGCGGCGCGCTCGAATTCTTCGCGCAGCCTCCTGGGCACCATGGGGCCGCCGCTGTGGCCG
GCGTCGGCCCTGAAGCAGCAGCGGCCTCGCACCCCGAACGAGCAACGGCCGACGTCGGCCGCGTCGGCTCGCGCG
ACGCCGACTCCGCGGGCCGTCCGCGCCGGGTCCGCCCACGGGACCGCAGAGATACACTCACCGACAAAGCTCACG
GTGCGGTCGAGGCAGTCCTCTGTCTCGTCCTTCGCGTCCGAACTCGACTGCCGGTTCAACATGCGAGCTGGCGAG
ATGGGCATAGACCCGACGGGGTTGAGCCCCAGCACAGACCCGCGCATGATCCAGGCTATCACGCAAACCATGATC
GGAGAGTTCCTCTGGAAATACACGCGGAAGACGGGGCGCGGCGAGATGTCGGAAAACAGGCACAGGCGGTACTTT
TGGGTCCATCCCTACACCAGAACGCTGTACTGGAGCAACCAAGATCCCTCATCGGCCGGACGCACCGAGCTCAAG
GCCAAGAGCGTGCCGATCGAGGGCGTGCGCGTCATGGACGACCACAACCCCATGCCGCCAGGGCTGCACCGCAAA
AGTCTGCTCATCATCTCCCCCGGACGGACCATCAAGTTCACGTGCACGACGGGCCAGCGACACGAGACGTGGTTC
AACGCCCTTTCCTATCTGTTGAAACGGACCAACCAGGACAGCCAGTCGGACGTGGAGGAAGTGGCGGAGACGATG
GCTCGCGACGAGGTCGAAGAGTTCAACCCCCAGTTCGGCCGTCGAGGCGCCAACGGAAACCGGGCGGGAGGCGTG
GCGCCGTCCCTGTCGTCGTACCACTCGCGGACGACGCGCAACGACGGACCGGCCGACGGGCTATCGTTGGACATC
CCGACCCTGACGCCGGCCAACAACAGGCAGTCGACGGCGACGCGGGCTTCGGCCGGCACGCTGGGCAAGTTGAGC
GGGTACTGGAAGGCGGCGCCCAAGCTGTCGGGGACGTTTTCGAGCCTGCGCGGCCGAGGCCCGGCGAGCCAGAGC
GTGGAGGTGTACGAGGCGAGCGTGGTGCACGACAGCGCCGAGGATCTGCGGGAGATGATGGAGCGGCAGGATCGG
GAGTCGGACCGGCTGGAGAATGTGAGGGCGTGCTGCGACGGCAAACACGACGTCGGAACGCTGAACCATGTTCCG
CGAAGAGGCCGCAGCCAGCTTTCGCACTCCCATCCGGGACCGGTCATGTCGAACGCGGCGCTGGCGGCGTCTCGC
TCCCGAACATGA
Gene >Hirsu2|8054
ATGGCTTCGTCCCTGGCCCCGGACGGCCGCCCGAGCCTCCCCGTGCCTGGGGAGGGCGCAACGGACCCGTTTGTC
GCTGTCGCCGCTTCCGCCTCCTCCGCGTCGACGCACCATCGCTTCTCCGACTTCGACCAGGAGCTCTTCGCCGCC
GGCCCTGCCTCGTCTCCAACGCAGGCCAAACGCGCACTCGAGGCTCACCTCGCGGACACCGACTACCGCCTCGAT
GAAGTCGGCAAGCTGGGCACCGCGCTCGTCTCCCAGCGTAAGGCGCTGGCCGCGCAGCTGGACGAGCTGGGCAAG
CTGCAGGCCGAGGGAAACATAGGGCCCGACTTGCGCAAGAAGCTTGTCGACATCGAGAAGGAGTACAACGATGTC
GCCCGCGAGTCGGCCCGCGTTTTCCTGCCCAAGCAGCGCGTGCCCAGCAACGAGACCAATCCTGGCTCCCCCTAC
GTCCCTGAGAGCCGAGGAGGCAGAGTGAGCCCTTGCCCAGCTCGCCTCGTGACCGAAACCTTTTGGGAGCCCCCG
CTGACCACCGTGTTAGCGATCCGTGAGCCCTTCCAAGTTCGAAAGCCAAGCCACCGGCTCTCCCACCAAGCTCAA
CGTCCCGAGCCGCAAAAGCCGCAACCAGCCGTCCAATCGCGTCCACGACATCGAGTTTGCCGCCGAGATCAGCAC
CTCGCTCATTGCTCAAGTCCGCAATCTGCAGACCCTGCTCTCCGAGCGGGACGAGGAGGTCAAGACCCTGCACGC
CGAGAGGTCCAAGCTCGAAATCGAGTCCGAGGGTCTGCAGCAGCGGCTGAGGACCCTTGACGAGAGCGAGCACCG
CTACAAGGAGGAAAACTGGAACCTCGAGACTCGTCTGCAGGAGCTTTCGTCGCAGCAGAGGGAAGCCGCCGATCG
GGAGAAGAGGCTTGCCCAGGCGCTCGGCATCTCCAACACCGAGAAGACGGCCGCCCAGAAGGAGCTGGACGAGGT
CAAGCTCTCCCACTCCAAGCTTGCCGAGGAGCATGCCGCCGCCGTCAAGCACCATGACATCGAACTCGGCACCGC
CAAGCGCTCCATGGTCATGGCCGAGGGCGAACGGGCTGCTCTGCAGCGCAAGATCGACGACCTGACCGGCCAGAA
CCAGGAGCTTGCCAAGGCCTTCTCTCTGCAGCGAGGCAGAGGCGCCGAGCGCGAGCACGCCGCGGGCAACAGCGA
TGACGACTTCGAGACGGCCGCCGACAACATGACCCCCGAACACTCGCCGCCGCCGTCGCCCATCAAGAGCACGCC
CAGACACTCCATGCTGGAGACGGAGACGGTCAAGACGTCGCTGCAGCACGCCCAGCGCACCATCCAGAGCCAGCG
CAACCTGCTCCACCGTGAGAAGACGGAGAAGCTCGAGCTGCGACGCATCATCCAGGACCTCCGTGACGACCTGGA
GAAGACCCGGAACGATGCCGCCGGCCTCACGTTCAACCGGCGGAGCCGCAAGGCTGACTCCAGGGACATGAAGAA
GCCTCCGCGCTTGCTCGGCAGCTTCCGGTCGAGCCGCCAAGAAATCGTTGTCGACGACGACCCGGAATGGGAGGA
CAACCCCGACGTGTCGCCCCGAGTCAACACCGCCCCCGCCCAGGCCGCCGCGACCGTCCTCCCTTCGATCGAGGC
ACGCGACGACTTCGAGACGGCCAACGAGGCGAGCGAGTCGGCCTTCGAGACGGCCAACGAGCGGGCCACGGAGAC
GGAAGACTTCCAGACGGGCCACGAAGAGCTCTCGGGCAGCGATACCGAGACCGAGACCGAGACCCCATCCCGGGG
CTTCGGTCGGATGAAGCGTCCCCCGAGCCTGCCGTCTGGTCTTGCCCGCCAAAGGAGTCGAGGTTCGTTCGACAG
CACCGCGTCGACGTCGGCCGATGAGCAGGACCTTCCGGAGGTCAAGACGCCCACGAAGTCGCTGACATCGCAACG
AAGCCGAATGCGCATCGGCCGCGGCACCTTTTCGCGCAGCAGGCAGGCCAGCGAGGAGCCCAACCTGCGAAGCAG
TCCCTCGAGCTACGCCAGCGGAGGGACCCCCCATGCCGGCCAGAGCCTCTTCACCGAGCTGCGCGACATGGGTGG
CAGCGATGAGGAGGAGTCTGGCGCCGGGACGCCCAGTCGCAGGAGTCTGCGCTCTGCAACCCCAGGCTCAATCCG
TCGCACTCTGTCGCCCCCGCCTGCCGTCCCCCGCCTGCCCAGAGTCATCATGGTCGATAGCGGCGCCATGACGGA
TCCCGTCAAGATCACTGACGACGTCTTCGAGGAGGTCGCTGAACGGCCCGTCTCCATGGAGTCTGTCGTCAACGC
GCCACTCGTCCACCCGTTGACGGCGTGGAGAGGCAGCCACGGTGCCGGCACGGACTCTTCACGTCCCTTGTCGAC
TGGGTCGGGGTCACATGGCGACGCGGGCGCGCAATACGAACAGGATATCGGAGACAAGCTCGCGCAGTTCCCCGT
ACCCCCGTCGTCCGCCCCTGTCGCGAGACCGCCGACCCCCCCAAGCCTGGGCTTCTCCCCCATCCAATCCCTGCA
CGTCGAGCCGCGGGCGGAAGTGCAGACACCGCCGACCCCCCCGGCCCTCTGCTTCACGCCTCTGGCCATGCAGCA
CGTCGAGCCGCGTCCCGATCCGGGCAGCCCTGCACCTGTCCTCTCCCTCTCGACCATTGTCTCCGAGGGGTCGGA
ACCCGTGGCAGAGCCGGACGTGCCCCGCGCGGAGCTCACCATGACCCCCGTCCTCGCGCAGGCCGTCGAGCCGAT
TGCTACACCGCCCCCCTCCCTGACCTTGTCTGTCATCTCCGCCGAGGCGGTAGAGCCAGTGGCAGAGCCAGAGCC
CATGATGACTGTGCCGCGGCTGGCCACCCCGGCCTTGCCGACGCTCAATTTGTCCAACATCATGTCGGAGACGAT
CGAGCCTGTCAGAGAACCTGCAATCATCGTCACGTCGCCGTCGCTCACCTTTTCGACCATCCGAGTGCAGGAGCT
GGAACCGAGGGAGGAGCCGGTGCTGACCCAGCCCCAGCCGCCGTTGGCCTTCTCGCACATCATGGCCGAACATGT
TCACCCCGTGTCCGAGCCGGAGCCCGTATGGCCGACCCTGTCGCTGTCCTCCATCGCCGCCCAGGACACCAGCCC
TATCATACCGCCCCTCCCCTCTCCTCCGACCCTGGCAATGTCCTCGATTGCATCCGAACACGTCGAGCCTGCGGG
CTCTCCTCTACTAGAGACGCCTTCTCTGCCCAACTTTGGCTTCTCAACAATCGAGTCCATTGAGACGCGACCGAT
CTCGCCGCGCAGCCCTAGGAGAGACGGCTTCATCCTTCCCCGAGACGATCACGTCCGTGACGGTTCCAATCCGCT
CGAGACTCCCTCGGGTACTAGGGCCCTGGGACTGGCGTTGGGCCGGGGCAAGAAGGACGACTTCGTACCCATGAT
CGCCGAAGACGAGACGCGCCAATCTCCGAGAGACAGCCCTGACGTGGGGACGCCCGAATCTCAGCGCCCATTCAA
GGAAATATCGAGCAACTCCATCTCTCGCTCACCGCGGAGGCAGCGCGAGCCGATGAGCGACCAAAGTGCCCAGAC
CTCCTTGACCTCGCAAGCCATCGACAAGCTGCTCAAGAGCGGCCCGCAGTCGGCGGGTAGCCACCTTTACCATAC
CTCGATGAGCTCGTTCGGCAGCCCCAACACCACGGGCACTGTCAGGATCCACCGATCGCAGGAGAGCCTGGACAG
CCCCGTTCGCGGCACTGCGATGGACGCGTCCGCATCCGAGGCGGATGGGCTAACCTTCCGACCGGGCAGCGCCAC
CAGTGTCGTCAGCGGCAAGGGCTCGACGACAAATCAGGACATGCCCCCGCCGCTCCCGCCCAACCACCGACAGAT
GATCAATGCGGCGCGCTCGAATTCTTCGCGCAGCCTCCTGGGCACCATGGGGCCGCCGCTGTGGCCGGCGTCGGC
CCTGAAGCAGCAGCGGCCTCGCACCCCGAACGAGCAACGGCCGACGTCGGCCGCGTCGGCTCGCGCGACGCCGAC
TCCGCGGGCCGTCCGCGCCGGGTCCGCCCACGGGACCGCAGAGATACACTCACCGACAAAGCTCACGGTGCGGTC
GAGGCAGTCCTCTGTCTCGTCCTTCGCGTCCGAACTCGACTGCCGGTTCAACATGCGAGCTGGCGAGATGGGCAT
AGACCCGACGGGGTTGAGCCCCAGCACAGACCCGCGCATGATCCAGGCTATCACGCAAACCATGATCGGAGAGTT
CCTCTGGAAATACACGCGGAAGACGGGGCGCGGCGAGATGTCGGAAAACAGGCACAGGCGGTACTTTTGGGTCCA
TCCCTACACCAGAACGCTGTACTGGAGCAACCAAGATCCCTCATCGGCCGGACGCACCGAGCTCAAGGCCAAGAG
CGTGCCGATCGAGGGCGTGCGCGTCATGGACGACCACAACCCCATGCCGCCAGGGCTGCACCGCAAAAGTCTGCT
CATCATCTCCCCCGGACGGACCATCAAGTTCACGTGCACGACGGGCCAGCGACACGAGACGTGGTTCAACGCCCT
TTCCTATCTGTTGAAACGGACCAACCAGGACAGCCAGTCGGACGTGGAGGAAGTGGCGGAGACGATGGCTCGCGA
CGAGGTCGAAGAGTTCAACCCCCAGTTCGGCCGTCGAGGCGCCAACGGAAACCGGGCGGGAGGCGTGGCGCCGTC
CCTGTCGTCGTACCACTCGCGGACGACGCGCAACGACGGACCGGCCGACGGGCTATCGTTGGACATCCCGACCCT
GACGCCGGCCAACAACAGGCAGTCGACGGCGACGCGGGCTTCGGCCGGCACGCTGGGCAAGTTGAGCGGGTACTG
GAAGGCGGCGCCCAAGCTGTCGGGGACGTTTTCGAGCCTGCGCGGCCGAGGCCCGGCGAGCCAGAGCGTGGAGGT
GTACGAGGCGAGCGTGGTGCACGACAGCGCCGAGGATCTGCGGGAGATGATGGAGCGGCAGGATCGGGAGTCGGA
CCGGCTGGAGAATGTGAGGGCGTGCTGCGACGGTACGTGTGGCGACCGGCGGCGGATCGAGGGTGATGCAGTGAA
CTGACCGGGCGAGTGCACAGGCAAACACGACGTCGGAACGCTGAACCATGTTCCGCGAAGAGGCCGCAGCCAGCT
TTCGCACTCCCATCCGGGACCGGTCATGTCGAACGCGGCGCTGGCGGCGTCTCGCTCCCGAACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail