Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8043
Gene name
LocationContig_500:2749..3127
Strand+
Gene length (bp)378
Transcript length (bp)378
Coding sequence length (bp)378
Protein length (aa) 126

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 4.8E-12 21 119

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 8 114 1.0E-13
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 3 114 6.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8043
MGSEFKIAIKKELYDLIRRGTWRLTEREKARGYPLPLKWVFTYKFDQDGYLQRYKARICVRGDLQDDDDGLETYA
ATLAAKTFRIAMATAARFDLDIRQFDIGNAFLYSDLNKDHPVYVGSRRTT*
Coding >Hirsu2|8043
ATGGGCTCAGAGTTCAAGATTGCCATCAAAAAGGAACTATACGACCTAATAAGACGAGGCACGTGGAGACTGACT
GAACGAGAAAAGGCTCGTGGATATCCGCTTCCACTGAAGTGGGTGTTCACGTATAAGTTCGATCAAGATGGGTAC
CTCCAGAGATATAAGGCACGCATCTGTGTCCGCGGAGATCTTCAAGATGACGATGACGGGTTAGAAACCTATGCA
GCCACTCTCGCGGCAAAGACCTTCCGGATCGCCATGGCAACTGCAGCACGATTCGACCTCGACATTAGACAATTT
GACATTGGCAATGCCTTCCTGTACAGCGACCTCAACAAGGACCACCCCGTCTACGTCGGCTCCCGCAGGACTACG
TAG
Transcript >Hirsu2|8043
ATGGGCTCAGAGTTCAAGATTGCCATCAAAAAGGAACTATACGACCTAATAAGACGAGGCACGTGGAGACTGACT
GAACGAGAAAAGGCTCGTGGATATCCGCTTCCACTGAAGTGGGTGTTCACGTATAAGTTCGATCAAGATGGGTAC
CTCCAGAGATATAAGGCACGCATCTGTGTCCGCGGAGATCTTCAAGATGACGATGACGGGTTAGAAACCTATGCA
GCCACTCTCGCGGCAAAGACCTTCCGGATCGCCATGGCAACTGCAGCACGATTCGACCTCGACATTAGACAATTT
GACATTGGCAATGCCTTCCTGTACAGCGACCTCAACAAGGACCACCCCGTCTACGTCGGCTCCCGCAGGACTACG
TAG
Gene >Hirsu2|8043
ATGGGCTCAGAGTTCAAGATTGCCATCAAAAAGGAACTATACGACCTAATAAGACGAGGCACGTGGAGACTGACT
GAACGAGAAAAGGCTCGTGGATATCCGCTTCCACTGAAGTGGGTGTTCACGTATAAGTTCGATCAAGATGGGTAC
CTCCAGAGATATAAGGCACGCATCTGTGTCCGCGGAGATCTTCAAGATGACGATGACGGGTTAGAAACCTATGCA
GCCACTCTCGCGGCAAAGACCTTCCGGATCGCCATGGCAACTGCAGCACGATTCGACCTCGACATTAGACAATTT
GACATTGGCAATGCCTTCCTGTACAGCGACCTCAACAAGGACCACCCCGTCTACGTCGGCTCCCGCAGGACTACG
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail