Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8029
Gene name
LocationContig_50:4359..4830
Strand-
Gene length (bp)471
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04934 Med6 MED6 mediator sub complex component 8.7E-33 13 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HED8|MED6_NEUCR Mediator of RNA polymerase II transcription subunit 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=med-6 PE=3 SV=1 8 145 1.0E-60
sp|Q4WDH9|MED6_ASPFU Mediator of RNA polymerase II transcription subunit 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=med6 PE=3 SV=1 5 146 3.0E-49
sp|Q5AYT1|MED6_EMENI Mediator of RNA polymerase II transcription subunit 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=med6 PE=3 SV=2 1 146 4.0E-47
sp|Q2U9E7|MED6_ASPOR Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=med6 PE=3 SV=1 7 146 1.0E-46
sp|A2R4I0|MED6_ASPNC Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=med6 PE=3 SV=2 1 146 2.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HED8|MED6_NEUCR Mediator of RNA polymerase II transcription subunit 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=med-6 PE=3 SV=1 8 145 1.0E-60
sp|Q4WDH9|MED6_ASPFU Mediator of RNA polymerase II transcription subunit 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=med6 PE=3 SV=1 5 146 3.0E-49
sp|Q5AYT1|MED6_EMENI Mediator of RNA polymerase II transcription subunit 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=med6 PE=3 SV=2 1 146 4.0E-47
sp|Q2U9E7|MED6_ASPOR Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=med6 PE=3 SV=1 7 146 1.0E-46
sp|A2R4I0|MED6_ASPNC Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=med6 PE=3 SV=2 1 146 2.0E-46
sp|Q0CH76|MED6_ASPTN Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=med6 PE=3 SV=2 7 146 5.0E-46
sp|Q1E3Z7|MED6_COCIM Mediator of RNA polymerase II transcription subunit 6 OS=Coccidioides immitis (strain RS) GN=MED6 PE=3 SV=2 7 146 2.0E-39
sp|Q6C3T0|MED6_YARLI Mediator of RNA polymerase II transcription subunit 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MED6 PE=3 SV=1 10 156 1.0E-24
sp|Q5A2Z1|MED6_CANAL Mediator of RNA polymerase II transcription subunit 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED6 PE=3 SV=1 10 146 2.0E-23
sp|Q6BIH7|MED6_DEBHA Mediator of RNA polymerase II transcription subunit 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MED6 PE=3 SV=2 9 140 3.0E-19
sp|Q9US45|MED6_SCHPO Mediator of RNA polymerase II transcription subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=med6 PE=1 SV=1 10 146 1.0E-16
sp|Q75EY3|MED6_ASHGO Mediator of RNA polymerase II transcription subunit 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MED6 PE=3 SV=1 6 146 3.0E-16
sp|A3LQ10|MED6_PICST Mediator of RNA polymerase II transcription subunit 6 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MED6 PE=3 SV=2 10 139 4.0E-15
sp|P38782|MED6_YEAST Mediator of RNA polymerase II transcription subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED6 PE=1 SV=1 6 146 6.0E-13
sp|Q6CTT6|MED6_KLULA Mediator of RNA polymerase II transcription subunit 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MED6 PE=3 SV=1 8 146 6.0E-13
sp|Q6FW12|MED6_CANGA Mediator of RNA polymerase II transcription subunit 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MED6 PE=3 SV=1 7 146 2.0E-12
sp|Q54PN3|MED6_DICDI Putative mediator of RNA polymerase II transcription subunit 6 OS=Dictyostelium discoideum GN=med6 PE=3 SV=1 7 145 5.0E-10
sp|Q4PHA6|MED6_USTMA Mediator of RNA polymerase II transcription subunit 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MED6 PE=3 SV=1 1 145 3.0E-08
sp|F4IXJ7|MED6_ARATH Mediator of RNA polymerase II transcription subunit 6 OS=Arabidopsis thaliana GN=MED6 PE=1 SV=1 27 147 2.0E-07
sp|Q921D4|MED6_MOUSE Mediator of RNA polymerase II transcription subunit 6 OS=Mus musculus GN=Med6 PE=1 SV=2 27 146 2.0E-07
sp|Q3SZY9|MED6_BOVIN Mediator of RNA polymerase II transcription subunit 6 OS=Bos taurus GN=MED6 PE=2 SV=1 27 146 3.0E-07
sp|O75586|MED6_HUMAN Mediator of RNA polymerase II transcription subunit 6 OS=Homo sapiens GN=MED6 PE=1 SV=2 27 146 3.0E-07
sp|Q5RD94|MED6_PONAB Mediator of RNA polymerase II transcription subunit 6 OS=Pongo abelii GN=MED6 PE=2 SV=1 27 146 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003712 transcription coregulator activity Yes
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0016592 mediator complex Yes
GO:0031326 regulation of cellular biosynthetic process No
GO:0044446 intracellular organelle part No
GO:2001141 regulation of RNA biosynthetic process No
GO:0044451 nucleoplasm part No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0050789 regulation of biological process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0044464 cell part No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0010468 regulation of gene expression No
GO:0006355 regulation of transcription, DNA-templated No
GO:0019222 regulation of metabolic process No
GO:0044428 nuclear part No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0003674 molecular_function No
GO:0044422 organelle part No
GO:0005575 cellular_component No
GO:0060255 regulation of macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 118 140 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8029
MATNPNDPPLDEIQWRSPPILAQMGGLHSNTILFYFAESPFFERTSNNAVIMSQAMNNMSMYHFIQTREAFEGRL
KTMSGLEFVVGEEPAETGPGMGTGVWVIRKQTRRKRYQDDDDIVLHALFFVVGENIYMAPALADIMASRIVRFPK
RGFSPA*
Coding >Hirsu2|8029
ATGGCGACGAACCCGAACGACCCGCCGCTGGACGAGATCCAGTGGCGGTCGCCGCCCATCCTCGCGCAGATGGGC
GGCCTGCACTCCAACACCATCCTCTTCTACTTCGCCGAGTCGCCCTTCTTCGAGCGGACGTCGAACAACGCGGTC
ATCATGAGCCAGGCGATGAACAACATGTCCATGTACCACTTCATCCAGACGCGCGAGGCCTTCGAGGGCCGCCTC
AAGACCATGTCGGGGCTCGAGTTCGTCGTCGGCGAGGAGCCGGCCGAGACGGGGCCCGGCATGGGCACCGGCGTC
TGGGTCATCCGCAAGCAGACGCGCCGCAAGCGCTACCAGGACGACGACGACATCGTCCTGCACGCCCTATTCTTC
GTCGTCGGCGAGAACATCTACATGGCGCCTGCGCTGGCCGACATCATGGCCTCGCGAATCGTACGTTTCCCGAAA
CGGGGCTTCTCTCCAGCGTGA
Transcript >Hirsu2|8029
ATGGCGACGAACCCGAACGACCCGCCGCTGGACGAGATCCAGTGGCGGTCGCCGCCCATCCTCGCGCAGATGGGC
GGCCTGCACTCCAACACCATCCTCTTCTACTTCGCCGAGTCGCCCTTCTTCGAGCGGACGTCGAACAACGCGGTC
ATCATGAGCCAGGCGATGAACAACATGTCCATGTACCACTTCATCCAGACGCGCGAGGCCTTCGAGGGCCGCCTC
AAGACCATGTCGGGGCTCGAGTTCGTCGTCGGCGAGGAGCCGGCCGAGACGGGGCCCGGCATGGGCACCGGCGTC
TGGGTCATCCGCAAGCAGACGCGCCGCAAGCGCTACCAGGACGACGACGACATCGTCCTGCACGCCCTATTCTTC
GTCGTCGGCGAGAACATCTACATGGCGCCTGCGCTGGCCGACATCATGGCCTCGCGAATCGTACGTTTCCCGAAA
CGGGGCTTCTCTCCAGCGTGA
Gene >Hirsu2|8029
ATGGCGACGAACCCGAACGACCCGCCGCTGGACGAGATCCAGTGGCGGTCGCCGCCCATCCTCGCGCAGATGGGC
GGCCTGCACTCCAACACCATCCTCTTCTACTTCGCCGAGTCGCCCTTCTTCGAGCGGACGTCGAACAACGCGGTC
ATCATGAGCCAGGCGATGAACAACATGTCCATGTACCACTTCATCCAGACGCGCGAGGCCTTCGAGGGCCGCCTC
AAGACCATGTCGGGGCTCGAGTTCGTCGTCGGCGAGGAGCCGGCCGAGACGGGGCCCGGCATGGGCACCGGCGTC
TGGGTCATCCGCAAGCAGACGCGCCGCAAGCGCTACCAGGACGACGACGACATCGTCCTGCACGCCCTATTCTTC
GTCGTCGGCGAGAACATCTACATGGCGCCTGCGCTGGCCGACATCATGGCCTCGCGAATCGTACGTTTCCCGAAA
CGGGGCTTCTCTCCAGCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail