© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|8029 |
| Gene name | |
| Location | Contig_50:4359..4830 |
| Strand | - |
| Gene length (bp) | 471 |
| Transcript length (bp) | 471 |
| Coding sequence length (bp) | 471 |
| Protein length (aa) | 157 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF04934 | Med6 | MED6 mediator sub complex component | 2.1E-33 | 13 | 147 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q9HED8|MED6_NEUCR | Mediator of RNA polymerase II transcription subunit 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=med-6 PE=3 SV=1 | 8 | 145 | 1.0E-60 |
| sp|Q4WDH9|MED6_ASPFU | Mediator of RNA polymerase II transcription subunit 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=med6 PE=3 SV=1 | 5 | 146 | 3.0E-49 |
| sp|Q5AYT1|MED6_EMENI | Mediator of RNA polymerase II transcription subunit 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=med6 PE=3 SV=2 | 1 | 146 | 4.0E-47 |
| sp|Q2U9E7|MED6_ASPOR | Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=med6 PE=3 SV=1 | 7 | 146 | 1.0E-46 |
| sp|A2R4I0|MED6_ASPNC | Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=med6 PE=3 SV=2 | 1 | 146 | 2.0E-46 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q9HED8|MED6_NEUCR | Mediator of RNA polymerase II transcription subunit 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=med-6 PE=3 SV=1 | 8 | 145 | 1.0E-60 |
| sp|Q4WDH9|MED6_ASPFU | Mediator of RNA polymerase II transcription subunit 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=med6 PE=3 SV=1 | 5 | 146 | 3.0E-49 |
| sp|Q5AYT1|MED6_EMENI | Mediator of RNA polymerase II transcription subunit 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=med6 PE=3 SV=2 | 1 | 146 | 4.0E-47 |
| sp|Q2U9E7|MED6_ASPOR | Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=med6 PE=3 SV=1 | 7 | 146 | 1.0E-46 |
| sp|A2R4I0|MED6_ASPNC | Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=med6 PE=3 SV=2 | 1 | 146 | 2.0E-46 |
| sp|Q0CH76|MED6_ASPTN | Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=med6 PE=3 SV=2 | 7 | 146 | 5.0E-46 |
| sp|Q1E3Z7|MED6_COCIM | Mediator of RNA polymerase II transcription subunit 6 OS=Coccidioides immitis (strain RS) GN=MED6 PE=3 SV=2 | 7 | 146 | 2.0E-39 |
| sp|Q6C3T0|MED6_YARLI | Mediator of RNA polymerase II transcription subunit 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MED6 PE=3 SV=1 | 10 | 156 | 1.0E-24 |
| sp|Q5A2Z1|MED6_CANAL | Mediator of RNA polymerase II transcription subunit 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED6 PE=3 SV=1 | 10 | 146 | 2.0E-23 |
| sp|Q6BIH7|MED6_DEBHA | Mediator of RNA polymerase II transcription subunit 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MED6 PE=3 SV=2 | 9 | 140 | 3.0E-19 |
| sp|Q9US45|MED6_SCHPO | Mediator of RNA polymerase II transcription subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=med6 PE=1 SV=1 | 10 | 146 | 1.0E-16 |
| sp|Q75EY3|MED6_ASHGO | Mediator of RNA polymerase II transcription subunit 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MED6 PE=3 SV=1 | 6 | 146 | 3.0E-16 |
| sp|A3LQ10|MED6_PICST | Mediator of RNA polymerase II transcription subunit 6 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MED6 PE=3 SV=2 | 10 | 139 | 4.0E-15 |
| sp|P38782|MED6_YEAST | Mediator of RNA polymerase II transcription subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED6 PE=1 SV=1 | 6 | 146 | 6.0E-13 |
| sp|Q6CTT6|MED6_KLULA | Mediator of RNA polymerase II transcription subunit 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MED6 PE=3 SV=1 | 8 | 146 | 6.0E-13 |
| sp|Q6FW12|MED6_CANGA | Mediator of RNA polymerase II transcription subunit 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MED6 PE=3 SV=1 | 7 | 146 | 2.0E-12 |
| sp|Q54PN3|MED6_DICDI | Putative mediator of RNA polymerase II transcription subunit 6 OS=Dictyostelium discoideum GN=med6 PE=3 SV=1 | 7 | 145 | 5.0E-10 |
| sp|Q4PHA6|MED6_USTMA | Mediator of RNA polymerase II transcription subunit 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MED6 PE=3 SV=1 | 1 | 145 | 3.0E-08 |
| sp|F4IXJ7|MED6_ARATH | Mediator of RNA polymerase II transcription subunit 6 OS=Arabidopsis thaliana GN=MED6 PE=1 SV=1 | 27 | 147 | 2.0E-07 |
| sp|Q921D4|MED6_MOUSE | Mediator of RNA polymerase II transcription subunit 6 OS=Mus musculus GN=Med6 PE=1 SV=2 | 27 | 146 | 2.0E-07 |
| sp|Q3SZY9|MED6_BOVIN | Mediator of RNA polymerase II transcription subunit 6 OS=Bos taurus GN=MED6 PE=2 SV=1 | 27 | 146 | 3.0E-07 |
| sp|O75586|MED6_HUMAN | Mediator of RNA polymerase II transcription subunit 6 OS=Homo sapiens GN=MED6 PE=1 SV=2 | 27 | 146 | 3.0E-07 |
| sp|Q5RD94|MED6_PONAB | Mediator of RNA polymerase II transcription subunit 6 OS=Pongo abelii GN=MED6 PE=2 SV=1 | 27 | 146 | 3.0E-07 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0003712 | transcription coregulator activity | Yes |
| GO:0016592 | mediator complex | Yes |
| GO:0006357 | regulation of transcription by RNA polymerase II | Yes |
| GO:0009889 | regulation of biosynthetic process | No |
| GO:0050789 | regulation of biological process | No |
| GO:0008150 | biological_process | No |
| GO:0010468 | regulation of gene expression | No |
| GO:2001141 | regulation of RNA biosynthetic process | No |
| GO:0050794 | regulation of cellular process | No |
| GO:0031323 | regulation of cellular metabolic process | No |
| GO:0019219 | regulation of nucleobase-containing compound metabolic process | No |
| GO:0051252 | regulation of RNA metabolic process | No |
| GO:0140110 | transcription regulator activity | No |
| GO:0032991 | protein-containing complex | No |
| GO:0010556 | regulation of macromolecule biosynthetic process | No |
| GO:1903506 | regulation of nucleic acid-templated transcription | No |
| GO:0019222 | regulation of metabolic process | No |
| GO:0031326 | regulation of cellular biosynthetic process | No |
| GO:0065007 | biological regulation | No |
| GO:0140513 | nuclear protein-containing complex | No |
| GO:0051171 | regulation of nitrogen compound metabolic process | No |
| GO:0060255 | regulation of macromolecule metabolic process | No |
| GO:0006355 | regulation of transcription, DNA-templated | No |
| GO:0003674 | molecular_function | No |
| GO:0005575 | cellular_component | No |
| GO:0080090 | regulation of primary metabolic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 11 | 0.45 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 20 | 42 | 22 |
| 2 | 118 | 140 | 22 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|8029 MATNPNDPPLDEIQWRSPPILAQMGGLHSNTILFYFAESPFFERTSNNAVIMSQAMNNMSMYHFIQTREAFEGRL KTMSGLEFVVGEEPAETGPGMGTGVWVIRKQTRRKRYQDDDDIVLHALFFVVGENIYMAPALADIMASRIVRFPK RGFSPA* |
| Coding | >Hirsu2|8029 ATGGCGACGAACCCGAACGACCCGCCGCTGGACGAGATCCAGTGGCGGTCGCCGCCCATCCTCGCGCAGATGGGC GGCCTGCACTCCAACACCATCCTCTTCTACTTCGCCGAGTCGCCCTTCTTCGAGCGGACGTCGAACAACGCGGTC ATCATGAGCCAGGCGATGAACAACATGTCCATGTACCACTTCATCCAGACGCGCGAGGCCTTCGAGGGCCGCCTC AAGACCATGTCGGGGCTCGAGTTCGTCGTCGGCGAGGAGCCGGCCGAGACGGGGCCCGGCATGGGCACCGGCGTC TGGGTCATCCGCAAGCAGACGCGCCGCAAGCGCTACCAGGACGACGACGACATCGTCCTGCACGCCCTATTCTTC GTCGTCGGCGAGAACATCTACATGGCGCCTGCGCTGGCCGACATCATGGCCTCGCGAATCGTACGTTTCCCGAAA CGGGGCTTCTCTCCAGCGTGA |
| Transcript | >Hirsu2|8029 ATGGCGACGAACCCGAACGACCCGCCGCTGGACGAGATCCAGTGGCGGTCGCCGCCCATCCTCGCGCAGATGGGC GGCCTGCACTCCAACACCATCCTCTTCTACTTCGCCGAGTCGCCCTTCTTCGAGCGGACGTCGAACAACGCGGTC ATCATGAGCCAGGCGATGAACAACATGTCCATGTACCACTTCATCCAGACGCGCGAGGCCTTCGAGGGCCGCCTC AAGACCATGTCGGGGCTCGAGTTCGTCGTCGGCGAGGAGCCGGCCGAGACGGGGCCCGGCATGGGCACCGGCGTC TGGGTCATCCGCAAGCAGACGCGCCGCAAGCGCTACCAGGACGACGACGACATCGTCCTGCACGCCCTATTCTTC GTCGTCGGCGAGAACATCTACATGGCGCCTGCGCTGGCCGACATCATGGCCTCGCGAATCGTACGTTTCCCGAAA CGGGGCTTCTCTCCAGCGTGA |
| Gene | >Hirsu2|8029 ATGGCGACGAACCCGAACGACCCGCCGCTGGACGAGATCCAGTGGCGGTCGCCGCCCATCCTCGCGCAGATGGGC GGCCTGCACTCCAACACCATCCTCTTCTACTTCGCCGAGTCGCCCTTCTTCGAGCGGACGTCGAACAACGCGGTC ATCATGAGCCAGGCGATGAACAACATGTCCATGTACCACTTCATCCAGACGCGCGAGGCCTTCGAGGGCCGCCTC AAGACCATGTCGGGGCTCGAGTTCGTCGTCGGCGAGGAGCCGGCCGAGACGGGGCCCGGCATGGGCACCGGCGTC TGGGTCATCCGCAAGCAGACGCGCCGCAAGCGCTACCAGGACGACGACGACATCGTCCTGCACGCCCTATTCTTC GTCGTCGGCGAGAACATCTACATGGCGCCTGCGCTGGCCGACATCATGGCCTCGCGAATCGTACGTTTCCCGAAA CGGGGCTTCTCTCCAGCGTGA |