Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8025
Gene name
LocationContig_5:94773..95673
Strand+
Gene length (bp)900
Transcript length (bp)900
Coding sequence length (bp)900
Protein length (aa) 300

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 100 290 1.0E-19
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 128 295 4.0E-16
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 145 290 3.0E-10
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 145 290 3.0E-10
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 145 290 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 100 290 1.0E-19
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 128 295 4.0E-16
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 145 290 3.0E-10
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 145 290 3.0E-10
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 145 290 4.0E-10
sp|P0CE68|NFT1_YEAST ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFT1 PE=3 SV=1 145 290 5.0E-10
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 125 299 2.0E-08
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 125 299 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 4 21 17
2 28 50 22
3 60 77 17
4 204 226 22
5 241 263 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8025
MALALDIGLCSIFLLLSLRSSHQQDPALSLLAAMLSSTYALCLVLAHAYVGHDCLSLSPSLRHHIILVYAAQWLF
TLTRARFVFAVASEIPHLEATLLRFAIFTALLLHHALASKRLADPPPGNDAADPPCTPTPEETASLASRLTQSWI
TNLIWKGRHEALESQHLWELARGEKSATVVSSYSWTTPSTLSLRKRLFCFLKRDILLQGIWAALASVAVFVPAQF
LRALIRCLESPDAMHTSAAWLMVVGLLVSALVAGVANTQCEWKGQKINARLRAVLVGEIYAKILRWKGATGGSV*
Coding >Hirsu2|8025
ATGGCTTTGGCGCTCGACATTGGCCTCTGCTCCATCTTCCTCCTCCTCTCCCTGCGCTCCAGCCACCAGCAGGAC
CCGGCCCTGTCGTTACTCGCCGCCATGCTGTCGTCCACCTACGCACTCTGCCTGGTCCTTGCCCACGCTTATGTT
GGCCACGACTGCCTCAGCCTTTCTCCGTCTCTGAGGCACCACATCATACTCGTCTACGCCGCGCAATGGCTGTTC
ACGCTCACGCGGGCCCGATTCGTCTTCGCCGTGGCGTCCGAGATCCCTCACTTAGAGGCAACGCTGCTTCGTTTC
GCCATCTTCACCGCACTCCTCCTGCATCACGCCCTCGCCTCGAAACGGCTGGCAGATCCGCCGCCAGGAAACGAT
GCCGCCGATCCGCCTTGCACACCTACGCCGGAAGAGACCGCCAGCCTCGCCTCTCGATTGACTCAGTCTTGGATA
ACCAATCTCATTTGGAAAGGGCGTCATGAGGCCCTCGAGTCGCAGCATCTCTGGGAGTTGGCAAGAGGCGAGAAG
TCGGCCACGGTTGTCTCGTCGTACAGTTGGACAACGCCCTCCACCTTATCTCTGCGCAAAAGACTGTTCTGCTTC
CTGAAGCGAGACATTCTGCTGCAGGGAATCTGGGCAGCCCTCGCGAGCGTGGCTGTCTTTGTCCCGGCGCAGTTT
CTCCGCGCCCTCATCCGATGCCTGGAGTCCCCCGATGCAATGCACACGAGCGCGGCTTGGCTGATGGTGGTCGGA
CTGCTCGTCTCGGCTCTTGTAGCAGGTGTCGCAAACACCCAGTGCGAGTGGAAGGGCCAGAAGATCAACGCAAGG
CTCAGGGCCGTCCTGGTCGGCGAAATCTACGCCAAGATTCTGCGGTGGAAAGGAGCGACGGGTGGCTCTGTATAG
Transcript >Hirsu2|8025
ATGGCTTTGGCGCTCGACATTGGCCTCTGCTCCATCTTCCTCCTCCTCTCCCTGCGCTCCAGCCACCAGCAGGAC
CCGGCCCTGTCGTTACTCGCCGCCATGCTGTCGTCCACCTACGCACTCTGCCTGGTCCTTGCCCACGCTTATGTT
GGCCACGACTGCCTCAGCCTTTCTCCGTCTCTGAGGCACCACATCATACTCGTCTACGCCGCGCAATGGCTGTTC
ACGCTCACGCGGGCCCGATTCGTCTTCGCCGTGGCGTCCGAGATCCCTCACTTAGAGGCAACGCTGCTTCGTTTC
GCCATCTTCACCGCACTCCTCCTGCATCACGCCCTCGCCTCGAAACGGCTGGCAGATCCGCCGCCAGGAAACGAT
GCCGCCGATCCGCCTTGCACACCTACGCCGGAAGAGACCGCCAGCCTCGCCTCTCGATTGACTCAGTCTTGGATA
ACCAATCTCATTTGGAAAGGGCGTCATGAGGCCCTCGAGTCGCAGCATCTCTGGGAGTTGGCAAGAGGCGAGAAG
TCGGCCACGGTTGTCTCGTCGTACAGTTGGACAACGCCCTCCACCTTATCTCTGCGCAAAAGACTGTTCTGCTTC
CTGAAGCGAGACATTCTGCTGCAGGGAATCTGGGCAGCCCTCGCGAGCGTGGCTGTCTTTGTCCCGGCGCAGTTT
CTCCGCGCCCTCATCCGATGCCTGGAGTCCCCCGATGCAATGCACACGAGCGCGGCTTGGCTGATGGTGGTCGGA
CTGCTCGTCTCGGCTCTTGTAGCAGGTGTCGCAAACACCCAGTGCGAGTGGAAGGGCCAGAAGATCAACGCAAGG
CTCAGGGCCGTCCTGGTCGGCGAAATCTACGCCAAGATTCTGCGGTGGAAAGGAGCGACGGGTGGCTCTGTATAG
Gene >Hirsu2|8025
ATGGCTTTGGCGCTCGACATTGGCCTCTGCTCCATCTTCCTCCTCCTCTCCCTGCGCTCCAGCCACCAGCAGGAC
CCGGCCCTGTCGTTACTCGCCGCCATGCTGTCGTCCACCTACGCACTCTGCCTGGTCCTTGCCCACGCTTATGTT
GGCCACGACTGCCTCAGCCTTTCTCCGTCTCTGAGGCACCACATCATACTCGTCTACGCCGCGCAATGGCTGTTC
ACGCTCACGCGGGCCCGATTCGTCTTCGCCGTGGCGTCCGAGATCCCTCACTTAGAGGCAACGCTGCTTCGTTTC
GCCATCTTCACCGCACTCCTCCTGCATCACGCCCTCGCCTCGAAACGGCTGGCAGATCCGCCGCCAGGAAACGAT
GCCGCCGATCCGCCTTGCACACCTACGCCGGAAGAGACCGCCAGCCTCGCCTCTCGATTGACTCAGTCTTGGATA
ACCAATCTCATTTGGAAAGGGCGTCATGAGGCCCTCGAGTCGCAGCATCTCTGGGAGTTGGCAAGAGGCGAGAAG
TCGGCCACGGTTGTCTCGTCGTACAGTTGGACAACGCCCTCCACCTTATCTCTGCGCAAAAGACTGTTCTGCTTC
CTGAAGCGAGACATTCTGCTGCAGGGAATCTGGGCAGCCCTCGCGAGCGTGGCTGTCTTTGTCCCGGCGCAGTTT
CTCCGCGCCCTCATCCGATGCCTGGAGTCCCCCGATGCAATGCACACGAGCGCGGCTTGGCTGATGGTGGTCGGA
CTGCTCGTCTCGGCTCTTGTAGCAGGTGTCGCAAACACCCAGTGCGAGTGGAAGGGCCAGAAGATCAACGCAAGG
CTCAGGGCCGTCCTGGTCGGCGAAATCTACGCCAAGATTCTGCGGTGGAAAGGAGCGACGGGTGGCTCTGTATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail