Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8022
Gene name
LocationContig_5:83564..87668
Strand-
Gene length (bp)4104
Transcript length (bp)4104
Coding sequence length (bp)4104
Protein length (aa) 1368

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 8.4E-22 93 284
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.7E-08 676 771
PF07714 Pkinase_Tyr Protein tyrosine kinase 1.4E-16 93 287
PF13606 Ank_3 Ankyrin repeat 5.0E-03 708 734

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q60855|RIPK1_MOUSE Receptor-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Ripk1 PE=1 SV=1 96 297 2.0E-12
sp|Q96S53|TESK2_HUMAN Dual specificity testis-specific protein kinase 2 OS=Homo sapiens GN=TESK2 PE=1 SV=1 130 279 9.0E-12
sp|Q9FID6|Y5392_ARATH Probable receptor-like protein kinase At5g39020 OS=Arabidopsis thaliana GN=At5g39020 PE=2 SV=1 130 279 1.0E-11
sp|Q924U5|TESK2_RAT Dual specificity testis-specific protein kinase 2 OS=Rattus norvegicus GN=Tesk2 PE=2 SV=1 130 279 1.0E-11
sp|Q13546|RIPK1_HUMAN Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens GN=RIPK1 PE=1 SV=3 96 280 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q60855|RIPK1_MOUSE Receptor-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Ripk1 PE=1 SV=1 96 297 2.0E-12
sp|Q96S53|TESK2_HUMAN Dual specificity testis-specific protein kinase 2 OS=Homo sapiens GN=TESK2 PE=1 SV=1 130 279 9.0E-12
sp|Q9FID6|Y5392_ARATH Probable receptor-like protein kinase At5g39020 OS=Arabidopsis thaliana GN=At5g39020 PE=2 SV=1 130 279 1.0E-11
sp|Q924U5|TESK2_RAT Dual specificity testis-specific protein kinase 2 OS=Rattus norvegicus GN=Tesk2 PE=2 SV=1 130 279 1.0E-11
sp|Q13546|RIPK1_HUMAN Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens GN=RIPK1 PE=1 SV=3 96 280 2.0E-11
sp|Q9ESL4|MLTK_MOUSE Mitogen-activated protein kinase kinase kinase MLT OS=Mus musculus GN=Zak PE=1 SV=1 130 283 5.0E-11
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 129 280 7.0E-11
sp|Q9NYL2|MLTK_HUMAN Mitogen-activated protein kinase kinase kinase MLT OS=Homo sapiens GN=ZAK PE=1 SV=3 130 283 9.0E-11
sp|Q8VCT9|TESK2_MOUSE Dual specificity testis-specific protein kinase 2 OS=Mus musculus GN=Tesk2 PE=1 SV=1 130 279 1.0E-10
sp|Q54Y90|Y0133_DICDI Probable serine/threonine-protein kinase DDB_G0278665 OS=Dictyostelium discoideum GN=DDB_G0278665 PE=3 SV=1 98 285 2.0E-10
sp|P0C5E2|Y1839_ARATH Probable serine/threonine-protein kinase At1g18390 OS=Arabidopsis thaliana GN=At1g18390 PE=2 SV=2 130 305 2.0E-10
sp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1 94 283 3.0E-10
sp|Q54TA1|DRKC_DICDI Probable serine/threonine-protein kinase drkC OS=Dictyostelium discoideum GN=drkC PE=3 SV=1 130 280 1.0E-09
sp|Q15569|TESK1_HUMAN Dual specificity testis-specific protein kinase 1 OS=Homo sapiens GN=TESK1 PE=1 SV=2 130 279 1.0E-09
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 69 284 1.0E-09
sp|O22558|STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana GN=STY8 PE=1 SV=2 80 283 1.0E-09
sp|O70146|TESK1_MOUSE Dual specificity testis-specific protein kinase 1 OS=Mus musculus GN=Tesk1 PE=1 SV=3 130 279 1.0E-09
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 130 283 2.0E-09
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 69 284 2.0E-09
sp|Q3ECH2|Y1670_ARATH Probable receptor-like protein kinase At1g67000 OS=Arabidopsis thaliana GN=At1g67000 PE=2 SV=2 130 279 2.0E-09
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 130 283 2.0E-09
sp|Q5VJL3|GDT9_DICDI Probable serine/threonine-protein kinase gdt9 OS=Dictyostelium discoideum GN=gdt9 PE=2 SV=2 178 285 2.0E-09
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 130 283 3.0E-09
sp|O22187|Y2232_ARATH Probable receptor-like protein kinase At2g23200 OS=Arabidopsis thaliana GN=At2g23200 PE=3 SV=1 118 284 3.0E-09
sp|Q63572|TESK1_RAT Dual specificity testis-specific protein kinase 1 OS=Rattus norvegicus GN=Tesk1 PE=1 SV=1 130 279 4.0E-09
sp|C0LGN2|Y3148_ARATH Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 OS=Arabidopsis thaliana GN=LRR-RLK PE=2 SV=1 97 278 4.0E-09
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 101 284 4.0E-09
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8 OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1 130 282 5.0E-09
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 121 283 5.0E-09
sp|Q55CY9|GDT8_DICDI Probable serine/threonine-protein kinase gdt8 OS=Dictyostelium discoideum GN=gdt8 PE=3 SV=1 132 285 5.0E-09
sp|Q9FID5|Y5393_ARATH Probable receptor-like protein kinase At5g39030 OS=Arabidopsis thaliana GN=At5g39030 PE=2 SV=1 130 279 8.0E-09
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 93 280 9.0E-09
sp|Q9XEC8|CRK38_ARATH Cysteine-rich receptor-like protein kinase 38 OS=Arabidopsis thaliana GN=CRK38 PE=3 SV=1 88 279 9.0E-09
sp|O65405|CRK28_ARATH Cysteine-rich receptor-like protein kinase 28 OS=Arabidopsis thaliana GN=CRK28 PE=3 SV=2 88 279 1.0E-08
sp|Q9SCZ4|FERON_ARATH Receptor-like protein kinase FERONIA OS=Arabidopsis thaliana GN=FER PE=1 SV=1 10 353 1.0E-08
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 130 283 2.0E-08
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 130 283 2.0E-08
sp|Q54H05|KINY_DICDI Probable serine/threonine-protein kinase kinY OS=Dictyostelium discoideum GN=kinY PE=2 SV=1 130 284 2.0E-08
sp|C0LGG7|Y1534_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53420 OS=Arabidopsis thaliana GN=At1g53420 PE=2 SV=2 129 278 3.0E-08
sp|D7SFH9|GPDL2_ARATH Glycerophosphodiester phosphodiesterase protein kinase domain-containing GDPDL2 OS=Arabidopsis thaliana GN=GDPDL2 PE=1 SV=1 93 283 3.0E-08
sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 70 283 3.0E-08
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 69 284 3.0E-08
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 130 284 3.0E-08
sp|Q90ZY4|SBK1_DANRE Serine/threonine-protein kinase SBK1 OS=Danio rerio GN=sbk1 PE=1 SV=1 131 284 3.0E-08
sp|Q8SSS9|QKGA_DICDI Probable serine/threonine-protein kinase qkgA OS=Dictyostelium discoideum GN=qkgA-1 PE=3 SV=2 130 283 4.0E-08
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 65 284 4.0E-08
sp|Q23915|KINX_DICDI Probable serine/threonine-protein kinase kinX OS=Dictyostelium discoideum GN=kinX PE=3 SV=2 130 283 4.0E-08
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 129 306 4.0E-08
sp|Q9FE20|PBS1_ARATH Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1 99 279 4.0E-08
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 113 283 5.0E-08
sp|Q5S007|LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens GN=LRRK2 PE=1 SV=2 118 297 5.0E-08
sp|Q5XF57|Y5576_ARATH Probable receptor-like serine/threonine-protein kinase At5g57670 OS=Arabidopsis thaliana GN=At5g57670 PE=2 SV=1 88 279 5.0E-08
sp|Q8S8S7|PUB34_ARATH U-box domain-containing protein 34 OS=Arabidopsis thaliana GN=PUB34 PE=3 SV=1 93 283 5.0E-08
sp|Q55DU7|GDT4_DICDI Probable serine/threonine-protein kinase gdt4 OS=Dictyostelium discoideum GN=gdt4 PE=3 SV=2 130 283 5.0E-08
sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 121 295 6.0E-08
sp|A8R7E6|CERK1_ARATH Chitin elicitor receptor kinase 1 OS=Arabidopsis thaliana GN=CERK1 PE=1 SV=1 113 283 7.0E-08
sp|Q6XHA5|ROC11_DICDI Probable serine/threonine-protein kinase roco11 OS=Dictyostelium discoideum GN=roco11 PE=3 SV=1 130 283 7.0E-08
sp|Q3EDL4|Y1154_ARATH Probable serine/threonine-protein kinase At1g01540 OS=Arabidopsis thaliana GN=At1g01540 PE=1 SV=2 130 279 8.0E-08
sp|Q8SQW2|CTK1_ENCCU Probable CTD kinase subunit alpha homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CTK1 PE=3 SV=1 130 300 8.0E-08
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 130 284 8.0E-08
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 130 283 9.0E-08
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 130 283 1.0E-07
sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 70 283 1.0E-07
sp|Q39086|SD17_ARATH Receptor-like serine/threonine-protein kinase SD1-7 OS=Arabidopsis thaliana GN=SD17 PE=1 SV=1 130 279 1.0E-07
sp|C0LGG9|Y5344_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=2 SV=2 130 278 1.0E-07
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 99 284 1.0E-07
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 93 280 1.0E-07
sp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 1 OS=Arabidopsis thaliana GN=HERK1 PE=1 SV=1 57 353 1.0E-07
sp|Q9LFP7|Y5158_ARATH Probable receptor-like protein kinase At5g15080 OS=Arabidopsis thaliana GN=At5g15080 PE=2 SV=1 130 279 1.0E-07
sp|Q9SRH7|Y3130_ARATH Receptor-like serine/threonine-protein kinase At3g01300 OS=Arabidopsis thaliana GN=At3g01300 PE=2 SV=1 130 279 1.0E-07
sp|Q5S006|LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus GN=Lrrk2 PE=1 SV=2 118 280 1.0E-07
sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 130 283 1.0E-07
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 88 280 2.0E-07
sp|Q9S972|SD16_ARATH Receptor-like serine/threonine-protein kinase SD1-6 OS=Arabidopsis thaliana GN=SD16 PE=1 SV=2 130 279 2.0E-07
sp|Q54VC0|Y9865_DICDI Probable serine/threonine-protein kinase DDB_G0280461 OS=Dictyostelium discoideum GN=DDB_G0280461 PE=3 SV=1 112 285 2.0E-07
sp|Q9SY89|Y1661_ARATH Putative G-type lectin S-receptor-like serine/threonine-protein kinase At1g61610 OS=Arabidopsis thaliana GN=At1g61610 PE=3 SV=1 71 279 2.0E-07
sp|Q9FLW0|Y5241_ARATH Probable receptor-like protein kinase At5g24010 OS=Arabidopsis thaliana GN=At5g24010 PE=1 SV=1 114 287 2.0E-07
sp|Q9FLJ8|Y5613_ARATH Probable receptor-like protein kinase At5g61350 OS=Arabidopsis thaliana GN=At5g61350 PE=2 SV=1 12 309 2.0E-07
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 81 280 2.0E-07
sp|C0LGG8|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1 130 278 3.0E-07
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 672 1100 3.0E-07
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 65 283 3.0E-07
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 130 283 3.0E-07
sp|Q95UN8|M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster GN=slpr PE=1 SV=1 93 283 3.0E-07
sp|Q9SR05|ANX1_ARATH Receptor-like protein kinase ANXUR1 OS=Arabidopsis thaliana GN=ANX1 PE=2 SV=1 26 287 3.0E-07
sp|Q0WRY5|CDL1_ARATH Serine/threonine-protein kinase CDL1 OS=Arabidopsis thaliana GN=CDL1 PE=1 SV=1 88 279 3.0E-07
sp|O48814|BIK1_ARATH Serine/threonine-protein kinase BIK1 OS=Arabidopsis thaliana GN=BIK1 PE=1 SV=1 97 283 4.0E-07
sp|Q66L42|M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus GN=Map3k10 PE=1 SV=2 130 283 4.0E-07
sp|Q86HG9|Y9871_DICDI Probable serine/threonine-protein kinase DDB_G0271682 OS=Dictyostelium discoideum GN=DDB_G0271682 PE=3 SV=2 130 283 4.0E-07
sp|Q7T2V3|M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis GN=map3k10 PE=1 SV=1 112 283 4.0E-07
sp|Q9FID9|Y5389_ARATH Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana GN=At5g38990 PE=2 SV=1 130 283 4.0E-07
sp|Q02779|M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens GN=MAP3K10 PE=1 SV=3 130 283 5.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 709 1187 5.0E-07
sp|Q3U1V8|M3K9_MOUSE Mitogen-activated protein kinase kinase kinase 9 OS=Mus musculus GN=Map3k9 PE=2 SV=2 130 283 6.0E-07
sp|Q61RA2|CHK1_CAEBR Serine/threonine-protein kinase chk-1 OS=Caenorhabditis briggsae GN=chk-1 PE=3 SV=1 130 258 6.0E-07
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 130 283 6.0E-07
sp|Q52WX2|SBK1_HUMAN Serine/threonine-protein kinase SBK1 OS=Homo sapiens GN=SBK1 PE=2 SV=1 156 284 6.0E-07
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 130 344 7.0E-07
sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 130 279 7.0E-07
sp|Q9ASQ6|Y1972_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g29720 OS=Arabidopsis thaliana GN=RFK1 PE=2 SV=3 50 278 8.0E-07
sp|P30530|UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Homo sapiens GN=AXL PE=1 SV=3 130 362 8.0E-07
sp|Q8QZX0|SBK1_MOUSE Serine/threonine-protein kinase SBK1 OS=Mus musculus GN=Sbk1 PE=2 SV=1 156 284 9.0E-07
sp|Q9Z335|SBK1_RAT Serine/threonine-protein kinase SBK1 OS=Rattus norvegicus GN=Sbk1 PE=1 SV=1 156 284 9.0E-07
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 130 283 9.0E-07
sp|P80192|M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens GN=MAP3K9 PE=1 SV=3 130 283 9.0E-07
sp|Q9XEC7|CRK37_ARATH Cysteine-rich receptor-like protein kinase 37 OS=Arabidopsis thaliana GN=CRK37 PE=3 SV=1 97 279 1.0E-06
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 130 283 1.0E-06
sp|Q9FII5|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR OS=Arabidopsis thaliana GN=TDR PE=1 SV=1 70 279 1.0E-06
sp|Q8H186|Y3545_ARATH Probable receptor-like protein kinase At3g55450 OS=Arabidopsis thaliana GN=At3g55450 PE=1 SV=1 130 283 1.0E-06
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 99 287 1.0E-06
sp|P0CD62|LIMKB_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0286997 OS=Dictyostelium discoideum GN=DDB_G0286997 PE=3 SV=1 130 280 1.0E-06
sp|Q5UQG7|YR818_MIMIV Putative serine/threonine-protein kinase/receptor R818 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R818 PE=3 SV=1 130 283 1.0E-06
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 130 283 1.0E-06
sp|Q9T0J1|CRK26_ARATH Cysteine-rich receptor-like protein kinase 26 OS=Arabidopsis thaliana GN=CRK26 PE=2 SV=1 95 279 1.0E-06
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 99 283 1.0E-06
sp|Q39203|SD22_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD2-2 OS=Arabidopsis thaliana GN=SD22 PE=1 SV=1 88 279 1.0E-06
sp|Q00993|UFO_MOUSE Tyrosine-protein kinase receptor UFO OS=Mus musculus GN=Axl PE=1 SV=2 130 362 1.0E-06
sp|Q1PEM5|PERK3_ARATH Proline-rich receptor-like protein kinase PERK3 OS=Arabidopsis thaliana GN=PERK3 PE=2 SV=2 129 291 1.0E-06
sp|Q54L00|LIMKA_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0287001 OS=Dictyostelium discoideum GN=DDB_G0287001 PE=3 SV=1 130 280 2.0E-06
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 64 313 2.0E-06
sp|Q0WVM4|Y2239_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g23950 OS=Arabidopsis thaliana GN=At2g23950 PE=2 SV=1 34 279 2.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 672 1100 2.0E-06
sp|Q9SJT0|Y2214_ARATH Probable receptor-like protein kinase At2g21480 OS=Arabidopsis thaliana GN=At2g21480 PE=3 SV=1 32 309 2.0E-06
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 130 281 2.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 676 1100 2.0E-06
sp|Q9FIJ6|ACCR4_ARATH Serine/threonine-protein kinase-like protein CCR4 OS=Arabidopsis thaliana GN=CCR4 PE=1 SV=1 130 279 2.0E-06
sp|Q75JK0|ZAK1_DICDI Dual specificity protein kinase zakA OS=Dictyostelium discoideum GN=zakA PE=1 SV=1 99 281 3.0E-06
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 91 283 3.0E-06
sp|Q16584|M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens GN=MAP3K11 PE=1 SV=1 130 289 3.0E-06
sp|Q39202|RLK1_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 OS=Arabidopsis thaliana GN=RLK1 PE=2 SV=2 70 279 3.0E-06
sp|Q55CZ1|GDT2_DICDI Probable serine/threonine-protein kinase gdt2 OS=Dictyostelium discoideum GN=gdt2 PE=2 SV=1 130 283 3.0E-06
sp|C0LGF4|FEI1_ARATH LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1 154 349 3.0E-06
sp|Q9Z2P5|RIPK3_RAT Receptor-interacting serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Ripk3 PE=1 SV=3 130 283 4.0E-06
sp|Q54G43|SHKE_DICDI Dual specificity protein kinase shkE OS=Dictyostelium discoideum GN=shkE PE=3 SV=1 129 298 5.0E-06
sp|C0LGH3|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=2 SV=2 130 278 5.0E-06
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 22 283 5.0E-06
sp|Q9FID8|Y5900_ARATH Putative receptor-like protein kinase At5g39000 OS=Arabidopsis thaliana GN=At5g39000 PE=3 SV=1 130 283 6.0E-06
sp|Q00655|KSYK_PIG Tyrosine-protein kinase SYK OS=Sus scrofa GN=SYK PE=1 SV=1 130 304 7.0E-06
sp|O22834|LRK53_ARATH Probable L-type lectin-domain containing receptor kinase V.3 OS=Arabidopsis thaliana GN=LECRK53 PE=3 SV=1 84 285 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0005515 protein binding Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0032555 purine ribonucleotide binding No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8022
MTTYAYPSTFPVESSGGAATDPEETQSTNESQRGAFASFICHVAHLESVLQPDKSFFDEARRKAVARTRLGYGTS
FLVDRVEMPAASGDAAGDSRFAVIKTVRQSAQNPMQWRDVLLEIRVLLHKPIRYHPNIVRLLGIGWDNSSEIASP
FPALIQEYAEFGTLAKLQADNKSLPFNIKQKLCYDVGRGLSILHACGIIHGDLKHENVLVFANKYSNPPDQPYTA
KVADFGGSVMDVREDSGTHILPMSTFPYEAPEIGQRLSVDGVKKTDAFSYGMLIWRCMLDCANVLATIGFIVPPG
RPREEQRTALNKLKSSDELLEGAIASLTRHAETRRLPRKSLGLIVTSLMFTLRGDPAQRALDRAQSRMRGMSASA
SHEYVSIKDVANKKMTEGLQRSTPGQHGIDMDGVGYALGRMAGDDYDAQNNLPGFRPDLPHPEKGGFLFEPLKLR
RLLAWEQQKNMVDEFVAAAEAPRYDSSAAGLEPWSASFFLYQSFLSGFGVRVDAEEACRWLRSAAKPSEETAGVD
YLAGAWLVRAHRALGVASPLTPDEQVDTLYWGLIRGHRHCGADARAMIEASSEAGQREGWEDRMMEADWNWRCRT
CATGMPFFISRRLTRQWDAEDVATLDETIKAELGDAYESCLRPALRDEDPVPLEPAPDGGNRFDRIYVNNKGHGL
LHLAATLGKVDVLRHVHRKYKCDISLSNQSHSDTPLTCACRAANLDCALYLLENGADANGTQFGQESPLHCIVNF
AETEMERIVKKLLEAGADIEKSTSASRKDVRGILSDWEDNSSIRLAPLGRAVLFQSLPAVRVLLRYGASPWGSPR
QADDKPGNVHPIQLAALLTLPEILQAMLTHSPTDSDPDAIPLFDECGMLQKARSGDVTRYDPLSLQSRIIRCGSQ
YKESLARTLGILRDRRLELGLVSQETSPGAQLCTEIGLGNRDIVEVLLDLGHALDGSVGNRPVEAAVTANNDDIF
FSVLVKRGASLSFADDEKSGRPLLLALAATRPHYTPRGTRIVEYLLSQGVSPEPRTQQQPSALTLAIKNGYMDLA
DVLVSRTSAESINAFHAWSDGGDAESVLGMLLSDHSNSNLQAISYLAEAHGNSASDLQVHPQVNKTKGLSAVHML
AQWPPSEWNDHSQISARIAQLVLAMFPDPQALGEHHVHPTLGTPLCAAVLAGNKNMVSILLESPYRSDVEKPVVL
EKQLGEATAKESWTPLRLINQAMETEARRLNSMLPAGRREDIDITKLMDSLDMMAQLNTAQGSPSALPTAQQIAQ
IKRQAEVALRQPRAAPVEDASDVVAADAPVDLSIISEEKPTHWHEGVEMTEIMALRTFLRSFRSKEGVFGDQITI
FMDKSFNKRPPELGAPE*
Coding >Hirsu2|8022
ATGACGACTTATGCCTACCCGTCCACCTTCCCCGTTGAATCCTCCGGCGGCGCGGCCACCGATCCGGAAGAGACG
CAGTCGACAAACGAGAGCCAGAGGGGAGCCTTTGCCTCCTTCATATGCCATGTTGCCCACTTGGAAAGTGTTCTC
CAGCCAGACAAGTCCTTCTTCGATGAGGCTCGCCGAAAAGCGGTCGCAAGGACGAGGCTCGGCTACGGCACCTCG
TTCCTCGTCGATCGAGTAGAAATGCCAGCCGCCAGCGGGGATGCAGCAGGCGATTCGAGGTTTGCCGTCATCAAA
ACAGTCCGCCAGAGCGCGCAGAACCCAATGCAGTGGCGAGACGTACTTTTGGAAATCAGAGTCCTGCTGCACAAG
CCCATCCGCTACCACCCCAACATCGTGCGACTCCTGGGCATCGGATGGGACAACTCCAGCGAGATAGCGTCGCCA
TTCCCGGCCCTGATCCAGGAGTATGCCGAGTTCGGCACGCTGGCTAAACTGCAGGCGGACAACAAGTCGCTTCCG
TTCAACATCAAGCAGAAGCTCTGCTACGACGTCGGCCGGGGGCTGTCCATCCTCCACGCCTGCGGCATCATCCAC
GGCGACCTCAAGCACGAGAATGTCCTCGTTTTTGCCAATAAATACTCGAACCCGCCAGACCAGCCGTATACGGCC
AAGGTTGCAGACTTTGGCGGAAGCGTCATGGACGTCCGCGAGGACAGCGGCACTCACATCCTCCCCATGAGCACT
TTCCCCTACGAGGCCCCCGAGATTGGCCAGAGACTGTCGGTAGACGGCGTGAAGAAGACGGATGCCTTTTCCTAC
GGCATGCTCATCTGGCGGTGCATGCTGGACTGCGCCAACGTCCTGGCCACGATAGGCTTTATCGTTCCACCGGGC
AGGCCGAGAGAGGAACAGCGGACAGCACTGAACAAGCTCAAGTCATCCGACGAGCTTCTCGAAGGCGCCATCGCA
AGCCTCACGAGGCATGCCGAGACTCGTAGGCTGCCCCGGAAGAGCCTCGGCCTCATCGTCACGTCCCTCATGTTC
ACCCTGCGTGGCGACCCGGCCCAGAGGGCTCTGGACCGCGCGCAAAGTCGGATGAGGGGCATGTCGGCCTCTGCC
TCTCACGAATACGTTTCGATCAAGGACGTGGCCAACAAGAAGATGACAGAAGGCTTGCAGCGCAGCACGCCCGGC
CAGCACGGCATCGACATGGACGGAGTTGGCTACGCTCTGGGACGCATGGCGGGCGACGACTACGACGCCCAAAAC
AACCTTCCAGGATTCCGACCGGATCTCCCGCACCCGGAGAAAGGCGGGTTCCTGTTCGAGCCGCTGAAGCTCCGA
CGTCTGCTCGCCTGGGAGCAGCAGAAGAACATGGTGGACGAGTTCGTGGCGGCGGCCGAGGCTCCGCGGTACGAT
AGCAGCGCCGCGGGCCTCGAGCCGTGGTCGGCTTCTTTCTTCTTGTACCAGAGCTTCTTGAGCGGTTTCGGGGTC
CGCGTCGACGCCGAAGAGGCCTGCCGCTGGCTCCGGTCTGCTGCCAAGCCCAGCGAGGAGACGGCGGGTGTGGAC
TACCTGGCCGGCGCCTGGCTTGTCCGGGCTCATCGCGCGCTCGGCGTCGCCAGCCCCCTTACGCCGGACGAGCAG
GTCGACACTCTGTACTGGGGCCTGATCAGAGGCCACCGGCACTGCGGCGCGGATGCCCGGGCTATGATCGAAGCC
TCGTCCGAGGCAGGCCAGCGGGAGGGCTGGGAGGACCGGATGATGGAGGCCGACTGGAACTGGCGATGCCGGACC
TGCGCGACTGGCATGCCATTCTTCATCTCGCGAAGGCTGACGCGTCAATGGGACGCCGAGGACGTCGCCACACTC
GATGAGACGATCAAGGCCGAGCTGGGAGACGCGTACGAATCGTGCTTGCGCCCGGCCTTGAGAGACGAGGATCCG
GTTCCGCTTGAGCCGGCGCCGGACGGCGGCAACAGGTTCGACCGCATCTATGTGAACAACAAAGGCCACGGACTT
CTCCATCTCGCTGCTACGTTGGGCAAAGTCGATGTGCTGAGGCATGTGCACCGCAAATACAAGTGCGACATCAGC
CTCAGCAACCAGTCGCACAGCGATACGCCTCTTACATGTGCCTGCCGCGCCGCTAACCTGGACTGCGCTCTGTAT
CTCCTCGAAAACGGTGCTGATGCCAACGGGACGCAGTTTGGTCAGGAGTCTCCGCTGCACTGCATTGTCAACTTT
GCCGAGACGGAGATGGAGAGGATAGTCAAGAAGCTGCTCGAGGCTGGCGCCGACATCGAGAAGTCCACCAGCGCG
TCCAGGAAGGATGTCCGAGGAATCCTGTCGGACTGGGAGGACAACTCTTCCATCAGGCTGGCGCCACTGGGCAGA
GCTGTTCTGTTCCAGAGCCTGCCGGCCGTGAGGGTTCTGCTCAGATACGGAGCAAGCCCCTGGGGAAGTCCCAGA
CAGGCTGACGACAAGCCGGGCAATGTACATCCCATCCAACTGGCGGCTCTCTTGACCTTGCCCGAAATCCTGCAG
GCTATGCTCACTCACTCTCCGACGGACAGCGATCCTGATGCGATCCCTCTGTTCGATGAGTGCGGAATGCTGCAG
AAGGCCCGCTCCGGCGACGTGACTCGATACGATCCGCTCTCCCTCCAGAGCCGGATCATTCGATGCGGGTCGCAA
TATAAGGAATCGCTGGCCCGAACCCTTGGCATACTAAGAGATAGACGGCTGGAGCTCGGGCTCGTCTCTCAGGAA
ACCTCGCCTGGCGCACAACTGTGTACCGAAATCGGCCTGGGAAATAGGGACATTGTCGAAGTGTTGCTCGATCTT
GGCCACGCCCTTGACGGCTCCGTCGGCAACCGGCCTGTTGAGGCTGCCGTGACGGCCAACAACGACGACATCTTC
TTCTCCGTGCTCGTCAAGCGCGGAGCTTCGTTGTCGTTTGCCGACGACGAGAAGTCTGGCCGGCCCTTGCTGCTG
GCTCTTGCTGCGACGCGTCCGCACTATACGCCCCGAGGCACACGCATCGTAGAGTACCTGCTGAGCCAGGGCGTT
TCCCCGGAGCCGAGGACTCAACAGCAGCCGTCCGCTCTGACGCTTGCCATCAAGAACGGATACATGGACCTGGCG
GATGTTCTTGTCTCCAGGACTTCGGCCGAGAGCATCAATGCGTTCCATGCATGGTCGGATGGTGGAGACGCAGAG
TCCGTCCTGGGCATGCTTCTTTCCGATCATTCGAACTCGAACCTCCAGGCCATCAGCTATCTGGCAGAAGCCCAC
GGCAACTCGGCCTCGGACCTCCAGGTACATCCTCAAGTCAACAAGACGAAGGGACTGTCCGCCGTCCACATGTTG
GCCCAGTGGCCGCCAAGCGAATGGAACGACCATTCGCAGATCTCGGCGCGGATCGCGCAACTCGTGCTGGCCATG
TTTCCTGACCCCCAGGCACTGGGAGAGCACCATGTCCATCCCACCTTGGGCACGCCGCTGTGCGCAGCCGTGCTT
GCGGGGAACAAGAACATGGTGAGCATACTGCTGGAGTCTCCGTACCGGAGCGACGTGGAAAAGCCGGTTGTGCTT
GAGAAGCAGCTCGGCGAGGCCACAGCCAAAGAGTCCTGGACACCCCTGCGACTGATCAACCAGGCCATGGAGACT
GAGGCCCGCCGGCTGAACAGCATGCTCCCTGCCGGCAGGAGAGAGGACATCGACATCACCAAGCTGATGGATTCC
TTGGACATGATGGCGCAGCTGAACACGGCCCAAGGCAGCCCGAGCGCGTTGCCCACCGCACAACAAATCGCACAG
ATCAAGAGGCAGGCCGAGGTGGCCCTGCGCCAGCCCAGGGCGGCACCAGTCGAGGACGCGTCCGACGTCGTGGCG
GCTGACGCCCCGGTGGACTTATCCATCATCAGCGAGGAGAAGCCGACGCACTGGCACGAGGGCGTGGAGATGACG
GAGATCATGGCGCTGAGAACCTTTCTCAGGTCCTTCCGCAGCAAGGAGGGGGTCTTTGGGGATCAAATCACGATC
TTCATGGACAAGTCCTTCAACAAGCGCCCGCCGGAGCTTGGGGCTCCGGAGTGA
Transcript >Hirsu2|8022
ATGACGACTTATGCCTACCCGTCCACCTTCCCCGTTGAATCCTCCGGCGGCGCGGCCACCGATCCGGAAGAGACG
CAGTCGACAAACGAGAGCCAGAGGGGAGCCTTTGCCTCCTTCATATGCCATGTTGCCCACTTGGAAAGTGTTCTC
CAGCCAGACAAGTCCTTCTTCGATGAGGCTCGCCGAAAAGCGGTCGCAAGGACGAGGCTCGGCTACGGCACCTCG
TTCCTCGTCGATCGAGTAGAAATGCCAGCCGCCAGCGGGGATGCAGCAGGCGATTCGAGGTTTGCCGTCATCAAA
ACAGTCCGCCAGAGCGCGCAGAACCCAATGCAGTGGCGAGACGTACTTTTGGAAATCAGAGTCCTGCTGCACAAG
CCCATCCGCTACCACCCCAACATCGTGCGACTCCTGGGCATCGGATGGGACAACTCCAGCGAGATAGCGTCGCCA
TTCCCGGCCCTGATCCAGGAGTATGCCGAGTTCGGCACGCTGGCTAAACTGCAGGCGGACAACAAGTCGCTTCCG
TTCAACATCAAGCAGAAGCTCTGCTACGACGTCGGCCGGGGGCTGTCCATCCTCCACGCCTGCGGCATCATCCAC
GGCGACCTCAAGCACGAGAATGTCCTCGTTTTTGCCAATAAATACTCGAACCCGCCAGACCAGCCGTATACGGCC
AAGGTTGCAGACTTTGGCGGAAGCGTCATGGACGTCCGCGAGGACAGCGGCACTCACATCCTCCCCATGAGCACT
TTCCCCTACGAGGCCCCCGAGATTGGCCAGAGACTGTCGGTAGACGGCGTGAAGAAGACGGATGCCTTTTCCTAC
GGCATGCTCATCTGGCGGTGCATGCTGGACTGCGCCAACGTCCTGGCCACGATAGGCTTTATCGTTCCACCGGGC
AGGCCGAGAGAGGAACAGCGGACAGCACTGAACAAGCTCAAGTCATCCGACGAGCTTCTCGAAGGCGCCATCGCA
AGCCTCACGAGGCATGCCGAGACTCGTAGGCTGCCCCGGAAGAGCCTCGGCCTCATCGTCACGTCCCTCATGTTC
ACCCTGCGTGGCGACCCGGCCCAGAGGGCTCTGGACCGCGCGCAAAGTCGGATGAGGGGCATGTCGGCCTCTGCC
TCTCACGAATACGTTTCGATCAAGGACGTGGCCAACAAGAAGATGACAGAAGGCTTGCAGCGCAGCACGCCCGGC
CAGCACGGCATCGACATGGACGGAGTTGGCTACGCTCTGGGACGCATGGCGGGCGACGACTACGACGCCCAAAAC
AACCTTCCAGGATTCCGACCGGATCTCCCGCACCCGGAGAAAGGCGGGTTCCTGTTCGAGCCGCTGAAGCTCCGA
CGTCTGCTCGCCTGGGAGCAGCAGAAGAACATGGTGGACGAGTTCGTGGCGGCGGCCGAGGCTCCGCGGTACGAT
AGCAGCGCCGCGGGCCTCGAGCCGTGGTCGGCTTCTTTCTTCTTGTACCAGAGCTTCTTGAGCGGTTTCGGGGTC
CGCGTCGACGCCGAAGAGGCCTGCCGCTGGCTCCGGTCTGCTGCCAAGCCCAGCGAGGAGACGGCGGGTGTGGAC
TACCTGGCCGGCGCCTGGCTTGTCCGGGCTCATCGCGCGCTCGGCGTCGCCAGCCCCCTTACGCCGGACGAGCAG
GTCGACACTCTGTACTGGGGCCTGATCAGAGGCCACCGGCACTGCGGCGCGGATGCCCGGGCTATGATCGAAGCC
TCGTCCGAGGCAGGCCAGCGGGAGGGCTGGGAGGACCGGATGATGGAGGCCGACTGGAACTGGCGATGCCGGACC
TGCGCGACTGGCATGCCATTCTTCATCTCGCGAAGGCTGACGCGTCAATGGGACGCCGAGGACGTCGCCACACTC
GATGAGACGATCAAGGCCGAGCTGGGAGACGCGTACGAATCGTGCTTGCGCCCGGCCTTGAGAGACGAGGATCCG
GTTCCGCTTGAGCCGGCGCCGGACGGCGGCAACAGGTTCGACCGCATCTATGTGAACAACAAAGGCCACGGACTT
CTCCATCTCGCTGCTACGTTGGGCAAAGTCGATGTGCTGAGGCATGTGCACCGCAAATACAAGTGCGACATCAGC
CTCAGCAACCAGTCGCACAGCGATACGCCTCTTACATGTGCCTGCCGCGCCGCTAACCTGGACTGCGCTCTGTAT
CTCCTCGAAAACGGTGCTGATGCCAACGGGACGCAGTTTGGTCAGGAGTCTCCGCTGCACTGCATTGTCAACTTT
GCCGAGACGGAGATGGAGAGGATAGTCAAGAAGCTGCTCGAGGCTGGCGCCGACATCGAGAAGTCCACCAGCGCG
TCCAGGAAGGATGTCCGAGGAATCCTGTCGGACTGGGAGGACAACTCTTCCATCAGGCTGGCGCCACTGGGCAGA
GCTGTTCTGTTCCAGAGCCTGCCGGCCGTGAGGGTTCTGCTCAGATACGGAGCAAGCCCCTGGGGAAGTCCCAGA
CAGGCTGACGACAAGCCGGGCAATGTACATCCCATCCAACTGGCGGCTCTCTTGACCTTGCCCGAAATCCTGCAG
GCTATGCTCACTCACTCTCCGACGGACAGCGATCCTGATGCGATCCCTCTGTTCGATGAGTGCGGAATGCTGCAG
AAGGCCCGCTCCGGCGACGTGACTCGATACGATCCGCTCTCCCTCCAGAGCCGGATCATTCGATGCGGGTCGCAA
TATAAGGAATCGCTGGCCCGAACCCTTGGCATACTAAGAGATAGACGGCTGGAGCTCGGGCTCGTCTCTCAGGAA
ACCTCGCCTGGCGCACAACTGTGTACCGAAATCGGCCTGGGAAATAGGGACATTGTCGAAGTGTTGCTCGATCTT
GGCCACGCCCTTGACGGCTCCGTCGGCAACCGGCCTGTTGAGGCTGCCGTGACGGCCAACAACGACGACATCTTC
TTCTCCGTGCTCGTCAAGCGCGGAGCTTCGTTGTCGTTTGCCGACGACGAGAAGTCTGGCCGGCCCTTGCTGCTG
GCTCTTGCTGCGACGCGTCCGCACTATACGCCCCGAGGCACACGCATCGTAGAGTACCTGCTGAGCCAGGGCGTT
TCCCCGGAGCCGAGGACTCAACAGCAGCCGTCCGCTCTGACGCTTGCCATCAAGAACGGATACATGGACCTGGCG
GATGTTCTTGTCTCCAGGACTTCGGCCGAGAGCATCAATGCGTTCCATGCATGGTCGGATGGTGGAGACGCAGAG
TCCGTCCTGGGCATGCTTCTTTCCGATCATTCGAACTCGAACCTCCAGGCCATCAGCTATCTGGCAGAAGCCCAC
GGCAACTCGGCCTCGGACCTCCAGGTACATCCTCAAGTCAACAAGACGAAGGGACTGTCCGCCGTCCACATGTTG
GCCCAGTGGCCGCCAAGCGAATGGAACGACCATTCGCAGATCTCGGCGCGGATCGCGCAACTCGTGCTGGCCATG
TTTCCTGACCCCCAGGCACTGGGAGAGCACCATGTCCATCCCACCTTGGGCACGCCGCTGTGCGCAGCCGTGCTT
GCGGGGAACAAGAACATGGTGAGCATACTGCTGGAGTCTCCGTACCGGAGCGACGTGGAAAAGCCGGTTGTGCTT
GAGAAGCAGCTCGGCGAGGCCACAGCCAAAGAGTCCTGGACACCCCTGCGACTGATCAACCAGGCCATGGAGACT
GAGGCCCGCCGGCTGAACAGCATGCTCCCTGCCGGCAGGAGAGAGGACATCGACATCACCAAGCTGATGGATTCC
TTGGACATGATGGCGCAGCTGAACACGGCCCAAGGCAGCCCGAGCGCGTTGCCCACCGCACAACAAATCGCACAG
ATCAAGAGGCAGGCCGAGGTGGCCCTGCGCCAGCCCAGGGCGGCACCAGTCGAGGACGCGTCCGACGTCGTGGCG
GCTGACGCCCCGGTGGACTTATCCATCATCAGCGAGGAGAAGCCGACGCACTGGCACGAGGGCGTGGAGATGACG
GAGATCATGGCGCTGAGAACCTTTCTCAGGTCCTTCCGCAGCAAGGAGGGGGTCTTTGGGGATCAAATCACGATC
TTCATGGACAAGTCCTTCAACAAGCGCCCGCCGGAGCTTGGGGCTCCGGAGTGA
Gene >Hirsu2|8022
ATGACGACTTATGCCTACCCGTCCACCTTCCCCGTTGAATCCTCCGGCGGCGCGGCCACCGATCCGGAAGAGACG
CAGTCGACAAACGAGAGCCAGAGGGGAGCCTTTGCCTCCTTCATATGCCATGTTGCCCACTTGGAAAGTGTTCTC
CAGCCAGACAAGTCCTTCTTCGATGAGGCTCGCCGAAAAGCGGTCGCAAGGACGAGGCTCGGCTACGGCACCTCG
TTCCTCGTCGATCGAGTAGAAATGCCAGCCGCCAGCGGGGATGCAGCAGGCGATTCGAGGTTTGCCGTCATCAAA
ACAGTCCGCCAGAGCGCGCAGAACCCAATGCAGTGGCGAGACGTACTTTTGGAAATCAGAGTCCTGCTGCACAAG
CCCATCCGCTACCACCCCAACATCGTGCGACTCCTGGGCATCGGATGGGACAACTCCAGCGAGATAGCGTCGCCA
TTCCCGGCCCTGATCCAGGAGTATGCCGAGTTCGGCACGCTGGCTAAACTGCAGGCGGACAACAAGTCGCTTCCG
TTCAACATCAAGCAGAAGCTCTGCTACGACGTCGGCCGGGGGCTGTCCATCCTCCACGCCTGCGGCATCATCCAC
GGCGACCTCAAGCACGAGAATGTCCTCGTTTTTGCCAATAAATACTCGAACCCGCCAGACCAGCCGTATACGGCC
AAGGTTGCAGACTTTGGCGGAAGCGTCATGGACGTCCGCGAGGACAGCGGCACTCACATCCTCCCCATGAGCACT
TTCCCCTACGAGGCCCCCGAGATTGGCCAGAGACTGTCGGTAGACGGCGTGAAGAAGACGGATGCCTTTTCCTAC
GGCATGCTCATCTGGCGGTGCATGCTGGACTGCGCCAACGTCCTGGCCACGATAGGCTTTATCGTTCCACCGGGC
AGGCCGAGAGAGGAACAGCGGACAGCACTGAACAAGCTCAAGTCATCCGACGAGCTTCTCGAAGGCGCCATCGCA
AGCCTCACGAGGCATGCCGAGACTCGTAGGCTGCCCCGGAAGAGCCTCGGCCTCATCGTCACGTCCCTCATGTTC
ACCCTGCGTGGCGACCCGGCCCAGAGGGCTCTGGACCGCGCGCAAAGTCGGATGAGGGGCATGTCGGCCTCTGCC
TCTCACGAATACGTTTCGATCAAGGACGTGGCCAACAAGAAGATGACAGAAGGCTTGCAGCGCAGCACGCCCGGC
CAGCACGGCATCGACATGGACGGAGTTGGCTACGCTCTGGGACGCATGGCGGGCGACGACTACGACGCCCAAAAC
AACCTTCCAGGATTCCGACCGGATCTCCCGCACCCGGAGAAAGGCGGGTTCCTGTTCGAGCCGCTGAAGCTCCGA
CGTCTGCTCGCCTGGGAGCAGCAGAAGAACATGGTGGACGAGTTCGTGGCGGCGGCCGAGGCTCCGCGGTACGAT
AGCAGCGCCGCGGGCCTCGAGCCGTGGTCGGCTTCTTTCTTCTTGTACCAGAGCTTCTTGAGCGGTTTCGGGGTC
CGCGTCGACGCCGAAGAGGCCTGCCGCTGGCTCCGGTCTGCTGCCAAGCCCAGCGAGGAGACGGCGGGTGTGGAC
TACCTGGCCGGCGCCTGGCTTGTCCGGGCTCATCGCGCGCTCGGCGTCGCCAGCCCCCTTACGCCGGACGAGCAG
GTCGACACTCTGTACTGGGGCCTGATCAGAGGCCACCGGCACTGCGGCGCGGATGCCCGGGCTATGATCGAAGCC
TCGTCCGAGGCAGGCCAGCGGGAGGGCTGGGAGGACCGGATGATGGAGGCCGACTGGAACTGGCGATGCCGGACC
TGCGCGACTGGCATGCCATTCTTCATCTCGCGAAGGCTGACGCGTCAATGGGACGCCGAGGACGTCGCCACACTC
GATGAGACGATCAAGGCCGAGCTGGGAGACGCGTACGAATCGTGCTTGCGCCCGGCCTTGAGAGACGAGGATCCG
GTTCCGCTTGAGCCGGCGCCGGACGGCGGCAACAGGTTCGACCGCATCTATGTGAACAACAAAGGCCACGGACTT
CTCCATCTCGCTGCTACGTTGGGCAAAGTCGATGTGCTGAGGCATGTGCACCGCAAATACAAGTGCGACATCAGC
CTCAGCAACCAGTCGCACAGCGATACGCCTCTTACATGTGCCTGCCGCGCCGCTAACCTGGACTGCGCTCTGTAT
CTCCTCGAAAACGGTGCTGATGCCAACGGGACGCAGTTTGGTCAGGAGTCTCCGCTGCACTGCATTGTCAACTTT
GCCGAGACGGAGATGGAGAGGATAGTCAAGAAGCTGCTCGAGGCTGGCGCCGACATCGAGAAGTCCACCAGCGCG
TCCAGGAAGGATGTCCGAGGAATCCTGTCGGACTGGGAGGACAACTCTTCCATCAGGCTGGCGCCACTGGGCAGA
GCTGTTCTGTTCCAGAGCCTGCCGGCCGTGAGGGTTCTGCTCAGATACGGAGCAAGCCCCTGGGGAAGTCCCAGA
CAGGCTGACGACAAGCCGGGCAATGTACATCCCATCCAACTGGCGGCTCTCTTGACCTTGCCCGAAATCCTGCAG
GCTATGCTCACTCACTCTCCGACGGACAGCGATCCTGATGCGATCCCTCTGTTCGATGAGTGCGGAATGCTGCAG
AAGGCCCGCTCCGGCGACGTGACTCGATACGATCCGCTCTCCCTCCAGAGCCGGATCATTCGATGCGGGTCGCAA
TATAAGGAATCGCTGGCCCGAACCCTTGGCATACTAAGAGATAGACGGCTGGAGCTCGGGCTCGTCTCTCAGGAA
ACCTCGCCTGGCGCACAACTGTGTACCGAAATCGGCCTGGGAAATAGGGACATTGTCGAAGTGTTGCTCGATCTT
GGCCACGCCCTTGACGGCTCCGTCGGCAACCGGCCTGTTGAGGCTGCCGTGACGGCCAACAACGACGACATCTTC
TTCTCCGTGCTCGTCAAGCGCGGAGCTTCGTTGTCGTTTGCCGACGACGAGAAGTCTGGCCGGCCCTTGCTGCTG
GCTCTTGCTGCGACGCGTCCGCACTATACGCCCCGAGGCACACGCATCGTAGAGTACCTGCTGAGCCAGGGCGTT
TCCCCGGAGCCGAGGACTCAACAGCAGCCGTCCGCTCTGACGCTTGCCATCAAGAACGGATACATGGACCTGGCG
GATGTTCTTGTCTCCAGGACTTCGGCCGAGAGCATCAATGCGTTCCATGCATGGTCGGATGGTGGAGACGCAGAG
TCCGTCCTGGGCATGCTTCTTTCCGATCATTCGAACTCGAACCTCCAGGCCATCAGCTATCTGGCAGAAGCCCAC
GGCAACTCGGCCTCGGACCTCCAGGTACATCCTCAAGTCAACAAGACGAAGGGACTGTCCGCCGTCCACATGTTG
GCCCAGTGGCCGCCAAGCGAATGGAACGACCATTCGCAGATCTCGGCGCGGATCGCGCAACTCGTGCTGGCCATG
TTTCCTGACCCCCAGGCACTGGGAGAGCACCATGTCCATCCCACCTTGGGCACGCCGCTGTGCGCAGCCGTGCTT
GCGGGGAACAAGAACATGGTGAGCATACTGCTGGAGTCTCCGTACCGGAGCGACGTGGAAAAGCCGGTTGTGCTT
GAGAAGCAGCTCGGCGAGGCCACAGCCAAAGAGTCCTGGACACCCCTGCGACTGATCAACCAGGCCATGGAGACT
GAGGCCCGCCGGCTGAACAGCATGCTCCCTGCCGGCAGGAGAGAGGACATCGACATCACCAAGCTGATGGATTCC
TTGGACATGATGGCGCAGCTGAACACGGCCCAAGGCAGCCCGAGCGCGTTGCCCACCGCACAACAAATCGCACAG
ATCAAGAGGCAGGCCGAGGTGGCCCTGCGCCAGCCCAGGGCGGCACCAGTCGAGGACGCGTCCGACGTCGTGGCG
GCTGACGCCCCGGTGGACTTATCCATCATCAGCGAGGAGAAGCCGACGCACTGGCACGAGGGCGTGGAGATGACG
GAGATCATGGCGCTGAGAACCTTTCTCAGGTCCTTCCGCAGCAAGGAGGGGGTCTTTGGGGATCAAATCACGATC
TTCATGGACAAGTCCTTCAACAAGCGCCCGCCGGAGCTTGGGGCTCCGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail