Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8015
Gene name
LocationContig_5:60978..61776
Strand+
Gene length (bp)798
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 3.4E-18 11 244

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.6403 0.2584 0.3093 0.0329 0.353 0.0365 0.2067 0.4125 0.2798 0.1254

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3998
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4304
Ophiocordyceps australis map64 (Brazil) OphauB2|5646
Ophiocordyceps camponoti-floridani Ophcf2|01603
Ophiocordyceps camponoti-rufipedis Ophun1|1573
Ophiocordyceps kimflemingae Ophio5|6821
Ophiocordyceps subramaniannii Hirsu2|8015 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8015
MSASAAPEKAVLIIPGAWHVPEHFNKLTAALESNGIRVICHRLPTSQNAESADTTIRDDVLFIQDVVKQQAALGT
HLIVVAHSYGGMVAASLAEFAVAPESSQGGVIAFVFLAAFLPTEDQSIVSVFGSTLPTFLATGPGGMIKCTEPML
CFFDDVNISAEEAQWANSLIVEYIHPSTNLAPVPSDKAAWRVIPSTYVFCEKDVILPPEVQDRMIQTARAQGAVV
HVHRLPSCHSPFLSMPEQVTQLILRAGGLSASTSSALPQS*
Coding >Hirsu2|8015
ATGTCAGCGTCTGCTGCACCAGAGAAAGCCGTCCTTATCATCCCTGGGGCCTGGCATGTTCCCGAACACTTCAAT
AAGCTCACCGCTGCACTCGAGTCGAATGGCATCCGCGTCATCTGCCACCGCTTGCCGACGAGCCAAAACGCCGAG
TCCGCCGACACGACGATCCGCGACGATGTGCTCTTCATCCAAGATGTCGTGAAGCAGCAGGCAGCGCTGGGGACG
CACCTCATTGTCGTCGCGCACTCATACGGAGGCATGGTCGCCGCATCCCTGGCCGAGTTCGCCGTCGCACCCGAG
TCCTCGCAAGGCGGCGTCATCGCCTTCGTCTTCCTGGCTGCCTTCCTGCCCACCGAGGACCAGTCGATAGTATCG
GTCTTCGGCAGCACGTTGCCAACGTTCTTGGCGACTGGGCCGGGGGGCATGATCAAGTGCACCGAACCGATGCTT
TGCTTCTTCGACGACGTCAACATCTCGGCCGAGGAGGCTCAGTGGGCAAACAGCCTTATAGTCGAGTACATACAT
CCTAGCACTAACCTAGCTCCTGTTCCGAGCGACAAGGCCGCTTGGCGAGTGATCCCCTCGACGTATGTTTTCTGT
GAGAAGGATGTGATACTGCCGCCCGAGGTGCAAGACCGCATGATTCAGACGGCCAGAGCGCAGGGCGCCGTGGTT
CATGTCCACCGGCTTCCGAGCTGTCACAGTCCGTTTCTGAGCATGCCAGAACAGGTCACACAGCTCATCCTACGG
GCTGGGGGTTTGTCGGCGTCCACTTCATCGGCACTGCCGCAGTCCTAG
Transcript >Hirsu2|8015
ATGTCAGCGTCTGCTGCACCAGAGAAAGCCGTCCTTATCATCCCTGGGGCCTGGCATGTTCCCGAACACTTCAAT
AAGCTCACCGCTGCACTCGAGTCGAATGGCATCCGCGTCATCTGCCACCGCTTGCCGACGAGCCAAAACGCCGAG
TCCGCCGACACGACGATCCGCGACGATGTGCTCTTCATCCAAGATGTCGTGAAGCAGCAGGCAGCGCTGGGGACG
CACCTCATTGTCGTCGCGCACTCATACGGAGGCATGGTCGCCGCATCCCTGGCCGAGTTCGCCGTCGCACCCGAG
TCCTCGCAAGGCGGCGTCATCGCCTTCGTCTTCCTGGCTGCCTTCCTGCCCACCGAGGACCAGTCGATAGTATCG
GTCTTCGGCAGCACGTTGCCAACGTTCTTGGCGACTGGGCCGGGGGGCATGATCAAGTGCACCGAACCGATGCTT
TGCTTCTTCGACGACGTCAACATCTCGGCCGAGGAGGCTCAGTGGGCAAACAGCCTTATAGTCGAGTACATACAT
CCTAGCACTAACCTAGCTCCTGTTCCGAGCGACAAGGCCGCTTGGCGAGTGATCCCCTCGACGTATGTTTTCTGT
GAGAAGGATGTGATACTGCCGCCCGAGGTGCAAGACCGCATGATTCAGACGGCCAGAGCGCAGGGCGCCGTGGTT
CATGTCCACCGGCTTCCGAGCTGTCACAGTCCGTTTCTGAGCATGCCAGAACAGGTCACACAGCTCATCCTACGG
GCTGGGGGTTTGTCGGCGTCCACTTCATCGGCACTGCCGCAGTCCTAG
Gene >Hirsu2|8015
ATGTCAGCGTCTGCTGCACCAGAGAAAGCCGTCCTTATCATCCCTGGGGCCTGGCATGTTCCCGAACACTTCAAT
AAGCTCACCGCTGCACTCGAGTCGAATGGCATCCGCGTCATCTGCCACCGCTTGCCGACGAGCCAAAACGCCGAG
TCCGCCGACACGACGATCCGCGACGATGTGCTCTTCATCCAAGATGTCGTGAAGCAGCAGGCAGCGCTGGGGACG
CACCTCATTGTCGTCGCGCACTCATACGGAGGCATGGTCGCCGCATCCCTGGCCGAGTTCGCCGTCGCACCCGAG
TCCTCGCAAGGCGGCGTCATCGCCTTCGTCTTCCTGGCTGCCTTCCTGCCCACCGAGGACCAGTCGATAGTATCG
GTCTTCGGCAGCACGTTGCCAACGTTCTTGGCGACTGGGCCGGGGGGCATGATCAAGTGCACCGAACCGATGCTT
TGCTTCTTCGACGACGTCAACATCTCGGCCGAGGAGGCTCAGTGGGCAAACAGCCTTATAGTCGAGTACATACAT
CCTAGCACTAACCTAGCTCCTGTTCCGAGCGACAAGGCCGCTTGGCGAGTGATCCCCTCGACGTATGTTTTCTGT
GAGAAGGATGTGATACTGCCGCCCGAGGTGCAAGACCGCATGATTCAGACGGCCAGAGCGCAGGGCGCCGTGGTT
CATGTCCACCGGCTTCCGAGCTGTCACAGTCCGTTTCTGAGCATGCCAGAACAGGTCACACAGCTCATCCTACGG
GCTGGGGGTTTGTCGGCGTCCACTTCATCGGCACTGCCGCAGTCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail