Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8006
Gene name
LocationContig_5:33240..34363
Strand+
Gene length (bp)1123
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT59|YKJ7_SCHPO Putative uncharacterized oxidoreductase C513.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC513.07 PE=3 SV=1 1 227 4.0E-29
sp|P14720|DFRA_PETHY Dihydroflavonol-4-reductase OS=Petunia hybrida GN=DFRA PE=2 SV=2 6 232 3.0E-17
sp|Q9CA28|TKPR2_ARATH Tetraketide alpha-pyrone reductase 2 OS=Arabidopsis thaliana GN=TKPR2 PE=1 SV=1 7 246 2.0E-16
sp|P51106|DFRA_HORVU Dihydroflavonol-4-reductase OS=Hordeum vulgare GN=ANT18 PE=3 SV=1 6 176 3.0E-15
sp|P51105|DFRA_GERHY Dihydroflavonol-4-reductase OS=Gerbera hybrida GN=DFR PE=2 SV=1 6 223 6.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT59|YKJ7_SCHPO Putative uncharacterized oxidoreductase C513.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC513.07 PE=3 SV=1 1 227 4.0E-29
sp|P14720|DFRA_PETHY Dihydroflavonol-4-reductase OS=Petunia hybrida GN=DFRA PE=2 SV=2 6 232 3.0E-17
sp|Q9CA28|TKPR2_ARATH Tetraketide alpha-pyrone reductase 2 OS=Arabidopsis thaliana GN=TKPR2 PE=1 SV=1 7 246 2.0E-16
sp|P51106|DFRA_HORVU Dihydroflavonol-4-reductase OS=Hordeum vulgare GN=ANT18 PE=3 SV=1 6 176 3.0E-15
sp|P51105|DFRA_GERHY Dihydroflavonol-4-reductase OS=Gerbera hybrida GN=DFR PE=2 SV=1 6 223 6.0E-15
sp|P83775|GRP2_CANAL Putative NADPH-dependent methylglyoxal reductase GRP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GRP2 PE=1 SV=2 6 227 7.0E-15
sp|Q9XES5|DFRA_MALDO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Malus domestica GN=DFR PE=1 SV=1 6 223 9.0E-15
sp|Q84KP0|DFRA_PYRCO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Pyrus communis GN=DFR PE=1 SV=1 6 223 1.0E-14
sp|Q9UUN9|ALD2_SPOSA Aldehyde reductase 2 OS=Sporidiobolus salmonicolor PE=1 SV=3 3 206 2.0E-14
sp|P51102|DFRA_ARATH Dihydroflavonol-4-reductase OS=Arabidopsis thaliana GN=DFRA PE=1 SV=2 4 224 4.0E-14
sp|P51110|DFRA_VITVI Dihydroflavonol-4-reductase OS=Vitis vinifera GN=DFR PE=1 SV=1 3 223 5.0E-14
sp|P53183|YGD9_YEAST Putative uncharacterized oxidoreductase YGL039W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL039W PE=1 SV=1 5 246 2.0E-13
sp|Q500U8|TKPR1_ARATH Tetraketide alpha-pyrone reductase 1 OS=Arabidopsis thaliana GN=TKPR1 PE=1 SV=1 6 232 3.0E-13
sp|P51107|DFRA_SOLLC Dihydroflavonol-4-reductase OS=Solanum lycopersicum PE=2 SV=1 6 224 4.0E-13
sp|P51109|DFRA_MEDSA Dihydroflavonol-4-reductase (Fragment) OS=Medicago sativa GN=DFR1 PE=2 SV=1 23 176 2.0E-12
sp|Q9SEV0|BAN_ARATH Anthocyanidin reductase OS=Arabidopsis thaliana GN=BAN PE=1 SV=2 10 231 3.0E-11
sp|P51103|DFRA_CALCH Dihydroflavonol-4-reductase OS=Callistephus chinensis GN=F PE=2 SV=1 6 224 8.0E-11
sp|P14721|DFRA_ANTMA Dihydroflavonol-4-reductase OS=Antirrhinum majus GN=DFRA PE=2 SV=1 6 224 2.0E-10
sp|P51104|DFRA_DIACA Dihydroflavonol-4-reductase OS=Dianthus caryophyllus GN=A PE=2 SV=1 3 224 4.0E-10
sp|Q12068|GRE2_YEAST NADPH-dependent methylglyoxal reductase GRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRE2 PE=1 SV=1 6 226 9.0E-10
sp|Q03049|YD541_YEAST Putative uncharacterized oxidoreductase YDR541C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR541C PE=3 SV=2 3 176 2.0E-09
sp|P51108|DFRA_MAIZE Dihydroflavonol-4-reductase OS=Zea mays GN=A1 PE=3 SV=1 6 176 3.0E-09
sp|O94563|YGD4_SCHPO Putative uncharacterized oxidoreductase C1773.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.04 PE=1 SV=1 3 226 4.0E-09
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5116 0.2674 0.3064 0.0484 0.4134 0.0484 0.0671 0.1035 0.0868 0.046

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4789
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|679
Ophiocordyceps australis map64 (Brazil) OphauB2|4300
Ophiocordyceps subramaniannii Hirsu2|10245
Ophiocordyceps subramaniannii Hirsu2|10633
Ophiocordyceps subramaniannii Hirsu2|119
Ophiocordyceps subramaniannii Hirsu2|8006 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8006
MAGDIVLLTGATGTIGFKTLVLLLEAGYTVRAATRNQAGFDKISSLSPIAKHKSQLSSFIVPDITIPGAFDEAVK
GVTYIPAIRGTVGILDSANKVTGIKRVVITASVASIASKSRFALGVIDENTLHVETEGPFSTGGAAYHASKALAF
QATKDFIKSKKPAFDVINILPVFVLGGDDTVTDLGSITKGSGGILMRLILGHAADAPITGIGVHIDDVAKMHVLS
LDPQIADWAESFEIVKRRFPKEYADA*
Coding >Hirsu2|8006
ATGGCAGGCGATATCGTTTTATTGACCGGTGCCACTGGCACGATTGGGTTCAAAACACTCGTCCTGCTCCTGGAA
GCTGGCTACACTGTCCGCGCCGCCACGCGCAACCAAGCCGGCTTCGATAAGATATCTTCTTTATCCCCGATAGCC
AAGCACAAGTCACAGCTCAGCAGCTTCATCGTCCCCGATATTACTATTCCCGGGGCATTCGACGAAGCAGTCAAG
GGCGTTACATACATTCCTGCTATTCGTGGGACGGTTGGCATTCTGGACTCCGCGAACAAGGTGACAGGTATCAAG
AGGGTAGTCATCACGGCTTCAGTGGCGTCGATTGCAAGTAAATCCCGATTTGCTTTGGGGGTGATCGATGAAAAT
ACACTTCATGTCGAGACTGAAGGCCCCTTTTCCACTGGCGGTGCTGCCTACCATGCTTCTAAGGCGCTCGCCTTT
CAAGCAACCAAAGACTTCATCAAGTCCAAGAAGCCCGCCTTTGATGTCATCAATATCCTCCCCGTCTTTGTTCTC
GGCGGAGACGACACTGTAACGGACTTGGGTTCCATCACCAAAGGTTCAGGAGGCATCCTGATGCGCCTCATCCTT
GGACACGCCGCAGACGCGCCTATCACTGGCATCGGCGTCCATATTGACGACGTAGCGAAGATGCACGTTCTCTCC
TTGGACCCTCAAATTGCCGATTGGGCGGAATCGTTCGAGATTGTGAAGAGGCGTTTCCCAAAGGAATACGCAGAC
GCGTGA
Transcript >Hirsu2|8006
ATGGCAGGCGATATCGTTTTATTGACCGGTGCCACTGGCACGATTGGGTTCAAAACACTCGTCCTGCTCCTGGAA
GCTGGCTACACTGTCCGCGCCGCCACGCGCAACCAAGCCGGCTTCGATAAGATATCTTCTTTATCCCCGATAGCC
AAGCACAAGTCACAGCTCAGCAGCTTCATCGTCCCCGATATTACTATTCCCGGGGCATTCGACGAAGCAGTCAAG
GGCGTTACATACATTCCTGCTATTCGTGGGACGGTTGGCATTCTGGACTCCGCGAACAAGGTGACAGGTATCAAG
AGGGTAGTCATCACGGCTTCAGTGGCGTCGATTGCAAGTAAATCCCGATTTGCTTTGGGGGTGATCGATGAAAAT
ACACTTCATGTCGAGACTGAAGGCCCCTTTTCCACTGGCGGTGCTGCCTACCATGCTTCTAAGGCGCTCGCCTTT
CAAGCAACCAAAGACTTCATCAAGTCCAAGAAGCCCGCCTTTGATGTCATCAATATCCTCCCCGTCTTTGTTCTC
GGCGGAGACGACACTGTAACGGACTTGGGTTCCATCACCAAAGGTTCAGGAGGCATCCTGATGCGCCTCATCCTT
GGACACGCCGCAGACGCGCCTATCACTGGCATCGGCGTCCATATTGACGACGTAGCGAAGATGCACGTTCTCTCC
TTGGACCCTCAAATTGCCGATTGGGCGGAATCGTTCGAGATTGTGAAGAGGCGTTTCCCAAAGGAATACGCAGAC
GCGTGA
Gene >Hirsu2|8006
ATGGCAGGCGATATCGTTTTAGTACGCTTTCTCGAACCGATTATCAATAAATAACCTCCACTAACAGACGCAGTT
GACCGGTGCCACTGGCACGATTGGGTTCAAAACACTCGTCCTGCTCCTGGAAGCTGGCTACACTGTCCGCGCCGC
CACGCGCAACCAAGCCGGCTTCGATAAGATATCTTCTTTATCCCCGATAGCCAAGCACAAGTCACAGCTCAGCAG
CTTCATCGTCCCCGATATTACTATTCCCGGGGCATTCGACGAAGCAGTCAAGGGCGTTACATACATTGTGCATGT
CGCATCTCCGTTGGCTCTCAACCTCCCGGGAGCTGATCCCGAAACCTCTATCATCCAGCCTGCTATTCGTGGGAC
GGTTGGCATTCTGGACTCCGCGAACAAGGTGACAGGTATCAAGAGGGTAGTCATCACGGCTTCAGTGGCGTCGAT
TGCAAGTAAATCCCGATTTGCTTTGGGGGTGATCGATGGTAAGCTTCTACGACGGCAATCTCGCTTTTTCAAATT
TTCTAACGAAAGGGCAGAAAATACACTTCATGTCGAGACTGAAGGCCCCTTTTCCACTGGCGGTGCTGCCTACCA
TGCTTCTAAGGCGCTCGCCTTTCAAGCAACCAAAGACTTCATCAAGTCCAAGAAGCCCGCCTTTGATGTCATCAA
TATCCTCCCCGTCTTTGTTCTCGGCGGAGACGACACTGTAACGGACTTGGGTTCCATCACCAAAGGTTCAGGAGG
CATCCTGATGCGCCTCATCCTTGGACACGCCGCAGACGCGCCTATCACTGGCATCGGCGTCCATATTGACGACGT
AGCGAAGATGCACGTTCTCTCCTTGGACCCTCAAATTGCCGGTAATCAGGATTTTCTCGCCGCTGGGCCCGAGCT
TGGACGCATAGATTGGGCGGAATCGTTCGAGATTGTGAAGAGGCGTTTCCCAAAGGAATACGCAGACGGTTTGTT
CAAGTTTGATGACATCCCGAAGCCTGTCACTCTTGAAGGCGAGGTTGATAACGCCAAGGCAAGGCAAGTGTTTGG
ACTGGAATTTAAGAGCTTTGAAGAGCAGGTGGTTTCGGCAGTGAACCGTTATTTAGAGCTTAGCAAAGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail