Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7993
Gene name
LocationContig_498:12565..17216
Strand+
Gene length (bp)4651
Transcript length (bp)4356
Coding sequence length (bp)4356
Protein length (aa) 1452

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13854 Kelch_5 Kelch motif 1.7E-07 281 317
PF13418 Kelch_4 Galactose oxidase, central domain 3.2E-04 226 275
PF13418 Kelch_4 Galactose oxidase, central domain 1.1E-04 284 325
PF13418 Kelch_4 Galactose oxidase, central domain 1.8E-04 334 384
PF13415 Kelch_3 Galactose oxidase, central domain 1.0E-05 294 342
PF13415 Kelch_3 Galactose oxidase, central domain 1.6E-05 345 393
PF13964 Kelch_6 Kelch motif 1.4E-09 284 325
PF01344 Kelch_1 Kelch motif 1.9E-09 284 325
PF07646 Kelch_2 Kelch motif 1.9E-06 285 329

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 100 1096 5.0E-87
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 101 427 3.0E-64
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 95 426 2.0E-61
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 130 401 2.0E-33
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 169 438 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 100 1096 5.0E-87
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 101 427 3.0E-64
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 95 426 2.0E-61
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 130 401 2.0E-33
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 169 438 1.0E-24
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 115 362 2.0E-23
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 170 420 2.0E-21
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 195 434 3.0E-21
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 162 414 1.0E-20
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 170 441 3.0E-20
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 162 414 3.0E-20
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 162 414 3.0E-20
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 163 403 5.0E-20
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 167 428 5.0E-20
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 173 415 8.0E-20
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 173 415 1.0E-19
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 173 415 2.0E-19
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 162 414 3.0E-19
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 169 404 3.0E-19
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 128 394 3.0E-19
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 157 403 2.0E-18
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 214 403 3.0E-18
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 214 403 3.0E-18
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 173 414 6.0E-18
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 173 414 7.0E-18
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 214 403 1.0E-17
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 214 403 2.0E-17
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 167 428 2.0E-17
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 106 394 3.0E-17
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 214 388 4.0E-17
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 229 404 9.0E-17
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 133 403 1.0E-16
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 192 434 1.0E-16
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 112 343 2.0E-16
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 168 415 4.0E-16
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 168 415 4.0E-16
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 167 428 4.0E-16
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 113 403 6.0E-16
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 168 355 7.0E-16
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 113 403 9.0E-16
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 113 403 1.0E-15
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 96 316 2.0E-15
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 96 316 2.0E-15
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 106 394 2.0E-15
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 226 403 3.0E-15
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 96 316 3.0E-15
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 115 394 4.0E-15
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 108 394 4.0E-15
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 179 383 6.0E-15
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 179 383 9.0E-15
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 282 442 1.0E-14
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 97 433 1.0E-14
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 179 383 1.0E-14
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 179 383 1.0E-14
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 172 404 1.0E-14
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 86 352 3.0E-14
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 101 316 6.0E-14
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 165 423 6.0E-14
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 282 428 6.0E-14
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 167 404 7.0E-14
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 168 355 9.0E-14
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 161 408 1.0E-13
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 172 403 1.0E-13
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 97 433 1.0E-13
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 114 391 2.0E-13
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 133 377 3.0E-13
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 133 377 3.0E-13
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 168 350 3.0E-13
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 170 428 4.0E-13
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 168 424 6.0E-13
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 183 352 6.0E-13
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 227 403 6.0E-13
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 204 355 7.0E-13
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 227 403 7.0E-13
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 183 352 7.0E-13
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 200 402 9.0E-13
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 170 428 9.0E-13
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 133 377 1.0E-12
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 166 362 1.0E-12
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 183 352 1.0E-12
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 165 428 2.0E-12
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 221 433 2.0E-12
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 268 428 3.0E-12
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 170 394 3.0E-12
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 133 369 3.0E-12
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 184 407 4.0E-12
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 170 394 4.0E-12
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 170 394 5.0E-12
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 184 407 5.0E-12
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 267 403 6.0E-12
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 197 447 7.0E-12
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 148 399 7.0E-12
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 267 403 8.0E-12
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 214 455 9.0E-12
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 213 402 9.0E-12
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 267 479 1.0E-11
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 161 409 1.0E-11
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 173 412 1.0E-11
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 210 406 1.0E-11
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 227 403 1.0E-11
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 100 369 2.0E-11
sp|A6NCF5|KLH33_HUMAN Kelch-like protein 33 OS=Homo sapiens GN=KLHL33 PE=4 SV=2 211 403 2.0E-11
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 183 352 2.0E-11
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 170 394 3.0E-11
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 148 399 3.0E-11
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 210 406 3.0E-11
sp|Q25386|SCRB_LIMPO Beta-scruin OS=Limulus polyphemus PE=2 SV=1 184 403 3.0E-11
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 170 406 3.0E-11
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 224 418 3.0E-11
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 168 444 3.0E-11
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 168 424 4.0E-11
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 168 424 4.0E-11
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 214 455 6.0E-11
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 184 407 6.0E-11
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 214 402 1.0E-10
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 214 403 5.0E-10
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 168 424 5.0E-10
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 220 451 7.0E-10
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 109 356 7.0E-10
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 311 428 7.0E-10
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 214 453 8.0E-10
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 214 403 1.0E-09
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 212 391 2.0E-09
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 206 405 3.0E-09
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 157 410 3.0E-09
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 173 446 4.0E-09
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 163 352 7.0E-09
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 170 306 9.0E-09
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 311 428 9.0E-09
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 148 370 1.0E-08
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 311 428 1.0E-08
sp|Q6A051|ATRN1_MOUSE Attractin-like protein 1 OS=Mus musculus GN=Atrnl1 PE=1 SV=2 161 415 1.0E-08
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 253 430 2.0E-08
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 224 415 2.0E-08
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 224 415 2.0E-08
sp|Q5ZLD3|KLH13_CHICK Kelch-like protein 13 OS=Gallus gallus GN=KLHL13 PE=2 SV=1 222 415 2.0E-08
sp|Q96M94|KLH15_HUMAN Kelch-like protein 15 OS=Homo sapiens GN=KLHL15 PE=1 SV=2 167 373 2.0E-08
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 213 404 3.0E-08
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 102 244 3.0E-08
sp|Q2T9Z7|KLHL9_BOVIN Kelch-like protein 9 OS=Bos taurus GN=KLHL9 PE=2 SV=1 222 415 3.0E-08
sp|Q9P2N7|KLH13_HUMAN Kelch-like protein 13 OS=Homo sapiens GN=KLHL13 PE=1 SV=3 222 415 3.0E-08
sp|A6QQY2|KLH13_BOVIN Kelch-like protein 13 OS=Bos taurus GN=KLHL13 PE=2 SV=1 222 415 3.0E-08
sp|Q5VV63|ATRN1_HUMAN Attractin-like protein 1 OS=Homo sapiens GN=ATRNL1 PE=2 SV=2 161 415 3.0E-08
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 228 373 4.0E-08
sp|Q6DEL7|KLH15_DANRE Kelch-like protein 15 OS=Danio rerio GN=klhl15 PE=2 SV=1 172 373 4.0E-08
sp|Q08979|KEL3_YEAST Kelch repeat-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL3 PE=1 SV=1 282 458 4.0E-08
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 329 418 5.0E-08
sp|Q9P2J3|KLHL9_HUMAN Kelch-like protein 9 OS=Homo sapiens GN=KLHL9 PE=1 SV=2 222 415 5.0E-08
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 138 403 6.0E-08
sp|Q80TF4|KLH13_MOUSE Kelch-like protein 13 OS=Mus musculus GN=Klhl13 PE=2 SV=3 199 415 6.0E-08
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 163 352 7.0E-08
sp|Q6ZPT1|KLHL9_MOUSE Kelch-like protein 9 OS=Mus musculus GN=Klhl9 PE=2 SV=2 222 415 7.0E-08
sp|P60882|MEGF8_MOUSE Multiple epidermal growth factor-like domains protein 8 OS=Mus musculus GN=Megf8 PE=1 SV=2 204 442 8.0E-08
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 148 363 9.0E-08
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 161 403 1.0E-07
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 218 415 1.0E-07
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 285 418 1.0E-07
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 148 370 2.0E-07
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 170 245 2.0E-07
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 138 403 2.0E-07
sp|A6NCF5|KLH33_HUMAN Kelch-like protein 33 OS=Homo sapiens GN=KLHL33 PE=4 SV=2 173 403 2.0E-07
sp|Q19981|TAG53_CAEEL Putative protein tag-53 OS=Caenorhabditis elegans GN=tag-53 PE=1 SV=3 140 403 2.0E-07
sp|Q9H0H3|KLH25_HUMAN Kelch-like protein 25 OS=Homo sapiens GN=KLHL25 PE=1 SV=1 167 402 2.0E-07
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 138 403 3.0E-07
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 173 425 3.0E-07
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 138 403 4.0E-07
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 224 423 5.0E-07
sp|Q8R2P1|KLH25_MOUSE Kelch-like protein 25 OS=Mus musculus GN=Klhl25 PE=2 SV=1 167 402 5.0E-07
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 224 415 6.0E-07
sp|Q25390|SCRA_LIMPO Alpha-scruin OS=Limulus polyphemus PE=2 SV=1 227 425 6.0E-07
sp|Q4KLM4|KLH25_RAT Kelch-like protein 25 OS=Rattus norvegicus GN=Klhl25 PE=2 SV=1 167 402 6.0E-07
sp|Q5RG82|NS1BA_DANRE Influenza virus NS1A-binding protein homolog A OS=Danio rerio GN=ivns1abpa PE=2 SV=1 190 375 6.0E-07
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 125 269 7.0E-07
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 168 353 8.0E-07
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 148 370 1.0E-06
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 224 423 1.0E-06
sp|Q6PF15|KLH35_HUMAN Kelch-like protein 35 OS=Homo sapiens GN=KLHL35 PE=1 SV=3 86 370 1.0E-06
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 652 1189 2.0E-06
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 95 353 2.0E-06
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 332 455 2.0E-06
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 175 324 2.0E-06
sp|Q0D2A9|KLH25_XENTR Kelch-like protein 25 OS=Xenopus tropicalis GN=klhl25 PE=2 SV=1 167 403 2.0E-06
sp|Q99JN2|KLH22_MOUSE Kelch-like protein 22 OS=Mus musculus GN=Klhl22 PE=1 SV=1 231 403 2.0E-06
sp|Q7Z7M0|MEGF8_HUMAN Multiple epidermal growth factor-like domains protein 8 OS=Homo sapiens GN=MEGF8 PE=1 SV=2 239 442 2.0E-06
sp|D3ZZC3|KLH22_RAT Kelch-like protein 22 OS=Rattus norvegicus GN=Klhl22 PE=1 SV=1 231 403 3.0E-06
sp|P60882|MEGF8_MOUSE Multiple epidermal growth factor-like domains protein 8 OS=Mus musculus GN=Megf8 PE=1 SV=2 101 368 5.0E-06
sp|Q5R774|KEAP1_PONAB Kelch-like ECH-associated protein 1 OS=Pongo abelii GN=KEAP1 PE=2 SV=1 172 457 5.0E-06
sp|Q14145|KEAP1_HUMAN Kelch-like ECH-associated protein 1 OS=Homo sapiens GN=KEAP1 PE=1 SV=2 172 457 5.0E-06
sp|O75882|ATRN_HUMAN Attractin OS=Homo sapiens GN=ATRN PE=1 SV=2 138 403 7.0E-06
sp|Q91XA8|KLD8A_MOUSE Kelch domain-containing protein 8A OS=Mus musculus GN=Klhdc8a PE=2 SV=1 222 417 7.0E-06
sp|Q684M4|KEAP1_PIG Kelch-like ECH-associated protein 1 OS=Sus scrofa GN=KEAP1 PE=3 SV=1 172 451 7.0E-06
sp|Q19981|TAG53_CAEEL Putative protein tag-53 OS=Caenorhabditis elegans GN=tag-53 PE=1 SV=3 166 403 8.0E-06
sp|O35709|ENC1_MOUSE Ectoderm-neural cortex protein 1 OS=Mus musculus GN=Enc1 PE=2 SV=2 167 402 8.0E-06
sp|Q9WU60|ATRN_MOUSE Attractin OS=Mus musculus GN=Atrn PE=1 SV=3 138 403 1.0E-05
sp|Q99J86|ATRN_RAT Attractin OS=Rattus norvegicus GN=Atrn PE=2 SV=1 138 403 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7993
MAFLFKSKKSQDRALASRDGNSAAQTPVQPARIARDEKTAAQQRATPTGSLNSLENDAAAASPEQGHGRRGGSVD
TTQQQSDLPLRNGLQSTNPNASLYPWSQRRLTYPSSSSGPFPRYGAAVNATSSKEGDVYMMGGLINSSTVRGDLW
MIEAGGNMSCYPLATTAEGPGPRVGHASLLVGNAFIVYGGDTKIEDSDVLDETLYLLNTSTRNWSRALPAGPRPS
GRYGHSLNILGSKIYIFGGQVEGFFMNDLSAFDLNQLQMPNNRWEILMQGDASPKIPAARTNHSMVTYNDKMFLF
GGTNGFQWFNDVWCYDPAVNSWSQLDCIGYIPAPREGHAAAIIEDVMYVFGGRTEEGSDLGDLAAFRISSRRWYT
FQNMGPSPSPRSGHSMTTVGKLIVVLGGEPSAASTAVNDLGILYVLDTAKIRYPNDSQQSSQQRAVQGRRPSGSD
VHSPVRQLQSRDGATGPPDPRKLTGAPAPVNGPPTAYKPTPPGGPDVNGPPHQGAPGAATAKASRSAMVSSPAGP
PPQGPTPAKPTGVVSSAGRVRGPSADRNGVPGSPPTRSVQSPVGRDGGIENDAGAVNGRRTPTQPVARPSKPESG
AADPAKAKQARHGQSQGSVDTSADRAQRPSSPPPPTRQSSNPVSRRLSGRNSQTVALLKELDSARNRNAWYASEL
ELARKAGYVSTAGFSPTLEAKVTESFDDEDRPLVEALLAMRTELANVQSAVDKQAVTAAKQIAEAEKQRDAAIQE
AVYAKAKMTAHVGGSGRSTAQSDGDPGGMGDRAGEMNRKLASALHAQKDLQSRLDGMTAELEAERRARKLADDTT
SAAQKRMTDLEAYKQQTSTEVERLKAELHLVQREAREQSVSSAEAIASLELLRVEKAEMASRYDEAMGSSREHNE
TFESLRSAIVASQDARAHLEKKLEEERLQRETLEDKFNKLRIEHEARSAELDAATKRLRDAEELAEKHVNEARTH
RQAVISGLDKISARDMPQAVKADSERLAALQNQIVTSNALVKKYKEEADAAADKLRSAEERIAGLEQYQEQSSRE
GVAIRRQLQSSLREVQSLQAAHSDIRNQLAAQQLETNAMTVQNNALKDILDERGISPTSAVRARALASPRTTSPE
QTRLRELESQLASASAAHEETRQVFAAQAQESELAYREKLAQLESDYQSAVHYVKGTEKMLKQLKDQLTRYKTDN
GRLKAEIEELENRLEGGAGDRSASSADLESERSGFQRRIEELEAKLRGSGAQLEKDVQSLRTELVESKRQRDEAL
RSSEEAARSLNLHRKDLEQLQSENSLLEQRATDAEQKVSLLLDQVENSVDSYRRRSRQIASLNSEGVGGSNGLEL
GHARHESTDTVSAYGGNGLDARNSAALDNLATELETLRSHWEATNKNYRLSSNFDFDQPAVGKEESEGAASLGLS
KSLADWRKRLDTDDAPHTGADKPHPS*
Coding >Hirsu2|7993
ATGGCCTTTCTCTTCAAGTCCAAGAAGAGCCAGGACCGCGCCTTGGCCAGCCGCGACGGCAACTCGGCGGCCCAA
ACCCCCGTCCAGCCTGCCCGCATCGCCCGCGATGAAAAGACTGCAGCGCAGCAGCGCGCCACGCCCACCGGGAGC
CTCAACTCCCTGGAAAACGACGCTGCCGCCGCCAGTCCCGAGCAGGGCCATGGACGTCGCGGTGGCAGCGTCGAC
ACAACCCAACAGCAAAGCGATCTACCGCTCCGCAACGGACTGCAGTCGACGAATCCGAACGCCTCGCTCTATCCT
TGGTCGCAGCGGCGCCTGACCTACCCCTCGTCGAGTTCGGGCCCCTTCCCCCGATATGGCGCCGCCGTCAACGCG
ACCTCTTCCAAGGAGGGCGACGTCTACATGATGGGCGGCCTGATCAACAGCTCGACCGTCAGGGGTGACCTCTGG
ATGATTGAGGCCGGCGGCAACATGTCTTGCTACCCGTTGGCAACGACGGCCGAGGGCCCGGGGCCGAGAGTCGGA
CACGCCAGCTTGCTGGTCGGCAACGCCTTCATCGTCTACGGTGGCGACACCAAGATCGAGGACTCCGACGTCTTG
GACGAGACGCTCTACCTTCTCAACACCTCAACACGGAATTGGTCGCGTGCCCTCCCCGCCGGTCCTCGCCCGTCC
GGCCGCTATGGACACTCGCTTAACATTCTAGGGTCCAAAATCTACATCTTTGGCGGCCAGGTCGAGGGCTTTTTC
ATGAACGATCTCTCCGCCTTTGATCTGAACCAGCTGCAGATGCCCAACAACCGGTGGGAGATACTAATGCAGGGC
GATGCCTCGCCCAAGATCCCCGCCGCCCGAACCAACCACTCTATGGTCACGTACAACGACAAGATGTTCTTGTTC
GGTGGCACCAATGGATTCCAATGGTTCAACGACGTCTGGTGCTACGATCCGGCTGTCAACTCGTGGTCGCAATTG
GACTGCATCGGCTACATCCCCGCCCCTCGCGAGGGACACGCGGCTGCGATCATCGAAGATGTCATGTATGTATTC
GGTGGTCGCACCGAGGAAGGCAGCGACTTGGGGGACCTGGCCGCCTTCCGGATATCCTCGAGACGGTGGTACACG
TTTCAAAACATGGGGCCCTCCCCATCGCCTCGGTCCGGCCACAGCATGACGACGGTAGGCAAGTTGATCGTCGTC
TTGGGCGGCGAACCCAGTGCTGCCTCCACCGCCGTCAACGATCTCGGCATACTCTACGTTCTGGATACGGCTAAG
ATCCGGTATCCCAACGACAGTCAGCAGAGCTCGCAGCAGAGGGCTGTTCAGGGCCGCCGGCCGAGTGGAAGCGAT
GTTCATAGCCCCGTTCGTCAGCTGCAGTCTCGCGATGGCGCAACGGGACCTCCGGATCCTCGCAAACTGACTGGT
GCTCCAGCCCCCGTGAACGGCCCCCCGACCGCATACAAGCCGACGCCACCGGGTGGCCCCGACGTCAACGGACCG
CCGCACCAAGGGGCTCCCGGAGCGGCGACGGCGAAGGCGTCCCGTTCGGCCATGGTCTCGAGTCCGGCCGGCCCG
CCGCCACAGGGGCCGACTCCGGCAAAGCCTACGGGGGTCGTGTCCAGCGCCGGACGAGTCCGTGGCCCTTCCGCC
GATCGGAATGGCGTCCCGGGCTCCCCACCGACCAGATCGGTCCAGTCTCCCGTTGGCCGCGACGGCGGGATCGAG
AACGATGCTGGCGCCGTCAACGGTCGGCGAACGCCGACACAGCCAGTGGCCCGACCCTCCAAGCCCGAGTCTGGC
GCGGCCGATCCGGCCAAAGCGAAGCAGGCCCGCCACGGGCAGTCTCAGGGCTCCGTCGACACCTCGGCGGACAGG
GCGCAGCGACCGTCCTCGCCCCCTCCTCCGACCCGTCAATCGAGCAATCCAGTGTCGAGACGCCTGTCCGGCCGC
AACTCCCAGACCGTCGCCCTTCTCAAAGAGCTAGATTCCGCACGGAATAGGAACGCTTGGTATGCTTCCGAGCTA
GAGCTGGCTCGAAAGGCAGGATACGTCTCTACCGCCGGCTTCAGCCCTACCCTCGAGGCCAAGGTGACTGAATCA
TTCGATGACGAAGATCGCCCCCTCGTCGAGGCCCTGCTGGCGATGCGGACCGAGCTGGCAAACGTGCAGAGCGCT
GTTGACAAGCAGGCAGTCACCGCCGCGAAGCAGATCGCCGAGGCAGAAAAGCAGCGGGACGCCGCCATCCAGGAG
GCAGTCTACGCCAAAGCCAAGATGACCGCTCACGTCGGCGGAAGCGGGAGGAGCACCGCCCAGTCGGACGGCGAC
CCGGGTGGCATGGGCGACAGAGCCGGCGAGATGAACCGCAAGCTCGCCTCCGCCTTGCACGCTCAAAAGGACCTG
CAGTCGCGGCTGGACGGCATGACGGCCGAGTTGGAGGCCGAGAGGAGGGCTCGGAAGCTTGCGGACGATACGACG
TCGGCAGCACAGAAGCGCATGACCGATCTTGAAGCCTACAAACAGCAGACGTCGACCGAGGTGGAGCGGCTTAAG
GCGGAGCTGCACCTCGTACAACGCGAAGCTCGCGAGCAGTCTGTCTCCAGTGCGGAGGCCATTGCATCATTGGAG
CTGTTGAGGGTAGAAAAGGCTGAGATGGCCTCCAGGTACGACGAGGCGATGGGAAGCTCAAGGGAGCACAACGAA
ACGTTCGAGTCCCTCAGGAGCGCCATAGTGGCCTCCCAAGACGCCAGAGCACACCTGGAGAAGAAACTGGAGGAG
GAACGGCTGCAGAGAGAGACGCTCGAGGACAAGTTCAACAAACTCAGGATCGAGCACGAGGCACGCAGCGCGGAG
CTCGACGCCGCCACGAAGCGTCTCAGGGACGCCGAAGAACTGGCCGAAAAACACGTCAACGAGGCAAGGACACAT
CGCCAGGCCGTCATATCCGGGCTAGACAAGATATCCGCTCGGGACATGCCTCAGGCCGTCAAGGCAGATTCCGAG
CGCCTCGCCGCCCTACAGAACCAGATCGTCACTTCGAACGCCCTGGTCAAGAAGTACAAGGAGGAGGCAGACGCG
GCGGCCGACAAGTTGCGCAGTGCCGAGGAGCGCATTGCCGGGCTGGAGCAGTACCAAGAGCAGTCCAGCCGAGAG
GGCGTCGCTATAAGACGACAGCTGCAGTCGTCGCTGAGAGAGGTGCAGAGCCTGCAAGCCGCGCACTCGGACATC
CGGAACCAGCTGGCGGCGCAGCAGCTCGAGACCAACGCCATGACGGTGCAGAACAATGCGCTCAAGGACATACTG
GACGAGCGCGGCATCAGCCCGACGAGTGCGGTGCGGGCGCGCGCCCTGGCCAGCCCGCGGACCACGTCTCCGGAA
CAGACCCGGCTGCGGGAGCTCGAATCGCAGCTCGCCAGCGCCAGCGCGGCACACGAGGAAACGAGACAGGTGTTC
GCGGCCCAGGCCCAGGAATCGGAGCTCGCGTACCGTGAGAAGCTTGCGCAGCTCGAGAGCGACTATCAATCGGCC
GTGCACTACGTCAAGGGGACCGAAAAGATGCTGAAGCAGCTGAAGGACCAGCTCACGCGCTACAAGACGGACAAC
GGCCGCCTCAAGGCCGAGATTGAGGAGCTCGAGAATCGCTTGGAGGGTGGGGCCGGAGACCGGTCGGCCTCCTCG
GCGGACCTGGAGAGCGAGCGCAGCGGCTTCCAGAGGAGGATCGAAGAGCTCGAGGCCAAGCTCCGGGGCTCGGGG
GCGCAGCTGGAAAAGGACGTGCAGTCGCTCAGGACAGAGCTGGTCGAAAGCAAGCGGCAGCGGGACGAGGCGCTC
AGGAGCAGCGAGGAGGCCGCCAGGAGCCTGAACCTGCATCGCAAGGACCTCGAGCAGCTGCAGTCGGAAAATTCG
CTGCTCGAGCAGCGCGCGACGGACGCGGAGCAGAAGGTGTCGCTGCTGCTGGACCAGGTGGAAAACTCGGTGGAC
AGCTACCGCCGACGCAGCCGCCAAATCGCCAGCCTCAACTCGGAGGGCGTCGGGGGCTCCAACGGGCTCGAGCTG
GGCCACGCCCGGCACGAGAGCACGGACACGGTGAGCGCGTACGGCGGCAACGGGCTGGACGCGAGGAACAGCGCC
GCACTGGACAACCTGGCGACGGAGCTGGAGACGCTGCGCAGCCACTGGGAGGCGACCAACAAGAACTACCGGCTG
AGCTCCAACTTCGACTTCGACCAGCCGGCCGTCGGCAAGGAGGAAAGCGAGGGCGCCGCCAGCCTCGGCCTGAGC
AAGAGCTTGGCCGACTGGCGAAAGAGGCTGGACACGGACGACGCGCCGCACACCGGCGCAGACAAGCCGCACCCG
AGCTGA
Transcript >Hirsu2|7993
ATGGCCTTTCTCTTCAAGTCCAAGAAGAGCCAGGACCGCGCCTTGGCCAGCCGCGACGGCAACTCGGCGGCCCAA
ACCCCCGTCCAGCCTGCCCGCATCGCCCGCGATGAAAAGACTGCAGCGCAGCAGCGCGCCACGCCCACCGGGAGC
CTCAACTCCCTGGAAAACGACGCTGCCGCCGCCAGTCCCGAGCAGGGCCATGGACGTCGCGGTGGCAGCGTCGAC
ACAACCCAACAGCAAAGCGATCTACCGCTCCGCAACGGACTGCAGTCGACGAATCCGAACGCCTCGCTCTATCCT
TGGTCGCAGCGGCGCCTGACCTACCCCTCGTCGAGTTCGGGCCCCTTCCCCCGATATGGCGCCGCCGTCAACGCG
ACCTCTTCCAAGGAGGGCGACGTCTACATGATGGGCGGCCTGATCAACAGCTCGACCGTCAGGGGTGACCTCTGG
ATGATTGAGGCCGGCGGCAACATGTCTTGCTACCCGTTGGCAACGACGGCCGAGGGCCCGGGGCCGAGAGTCGGA
CACGCCAGCTTGCTGGTCGGCAACGCCTTCATCGTCTACGGTGGCGACACCAAGATCGAGGACTCCGACGTCTTG
GACGAGACGCTCTACCTTCTCAACACCTCAACACGGAATTGGTCGCGTGCCCTCCCCGCCGGTCCTCGCCCGTCC
GGCCGCTATGGACACTCGCTTAACATTCTAGGGTCCAAAATCTACATCTTTGGCGGCCAGGTCGAGGGCTTTTTC
ATGAACGATCTCTCCGCCTTTGATCTGAACCAGCTGCAGATGCCCAACAACCGGTGGGAGATACTAATGCAGGGC
GATGCCTCGCCCAAGATCCCCGCCGCCCGAACCAACCACTCTATGGTCACGTACAACGACAAGATGTTCTTGTTC
GGTGGCACCAATGGATTCCAATGGTTCAACGACGTCTGGTGCTACGATCCGGCTGTCAACTCGTGGTCGCAATTG
GACTGCATCGGCTACATCCCCGCCCCTCGCGAGGGACACGCGGCTGCGATCATCGAAGATGTCATGTATGTATTC
GGTGGTCGCACCGAGGAAGGCAGCGACTTGGGGGACCTGGCCGCCTTCCGGATATCCTCGAGACGGTGGTACACG
TTTCAAAACATGGGGCCCTCCCCATCGCCTCGGTCCGGCCACAGCATGACGACGGTAGGCAAGTTGATCGTCGTC
TTGGGCGGCGAACCCAGTGCTGCCTCCACCGCCGTCAACGATCTCGGCATACTCTACGTTCTGGATACGGCTAAG
ATCCGGTATCCCAACGACAGTCAGCAGAGCTCGCAGCAGAGGGCTGTTCAGGGCCGCCGGCCGAGTGGAAGCGAT
GTTCATAGCCCCGTTCGTCAGCTGCAGTCTCGCGATGGCGCAACGGGACCTCCGGATCCTCGCAAACTGACTGGT
GCTCCAGCCCCCGTGAACGGCCCCCCGACCGCATACAAGCCGACGCCACCGGGTGGCCCCGACGTCAACGGACCG
CCGCACCAAGGGGCTCCCGGAGCGGCGACGGCGAAGGCGTCCCGTTCGGCCATGGTCTCGAGTCCGGCCGGCCCG
CCGCCACAGGGGCCGACTCCGGCAAAGCCTACGGGGGTCGTGTCCAGCGCCGGACGAGTCCGTGGCCCTTCCGCC
GATCGGAATGGCGTCCCGGGCTCCCCACCGACCAGATCGGTCCAGTCTCCCGTTGGCCGCGACGGCGGGATCGAG
AACGATGCTGGCGCCGTCAACGGTCGGCGAACGCCGACACAGCCAGTGGCCCGACCCTCCAAGCCCGAGTCTGGC
GCGGCCGATCCGGCCAAAGCGAAGCAGGCCCGCCACGGGCAGTCTCAGGGCTCCGTCGACACCTCGGCGGACAGG
GCGCAGCGACCGTCCTCGCCCCCTCCTCCGACCCGTCAATCGAGCAATCCAGTGTCGAGACGCCTGTCCGGCCGC
AACTCCCAGACCGTCGCCCTTCTCAAAGAGCTAGATTCCGCACGGAATAGGAACGCTTGGTATGCTTCCGAGCTA
GAGCTGGCTCGAAAGGCAGGATACGTCTCTACCGCCGGCTTCAGCCCTACCCTCGAGGCCAAGGTGACTGAATCA
TTCGATGACGAAGATCGCCCCCTCGTCGAGGCCCTGCTGGCGATGCGGACCGAGCTGGCAAACGTGCAGAGCGCT
GTTGACAAGCAGGCAGTCACCGCCGCGAAGCAGATCGCCGAGGCAGAAAAGCAGCGGGACGCCGCCATCCAGGAG
GCAGTCTACGCCAAAGCCAAGATGACCGCTCACGTCGGCGGAAGCGGGAGGAGCACCGCCCAGTCGGACGGCGAC
CCGGGTGGCATGGGCGACAGAGCCGGCGAGATGAACCGCAAGCTCGCCTCCGCCTTGCACGCTCAAAAGGACCTG
CAGTCGCGGCTGGACGGCATGACGGCCGAGTTGGAGGCCGAGAGGAGGGCTCGGAAGCTTGCGGACGATACGACG
TCGGCAGCACAGAAGCGCATGACCGATCTTGAAGCCTACAAACAGCAGACGTCGACCGAGGTGGAGCGGCTTAAG
GCGGAGCTGCACCTCGTACAACGCGAAGCTCGCGAGCAGTCTGTCTCCAGTGCGGAGGCCATTGCATCATTGGAG
CTGTTGAGGGTAGAAAAGGCTGAGATGGCCTCCAGGTACGACGAGGCGATGGGAAGCTCAAGGGAGCACAACGAA
ACGTTCGAGTCCCTCAGGAGCGCCATAGTGGCCTCCCAAGACGCCAGAGCACACCTGGAGAAGAAACTGGAGGAG
GAACGGCTGCAGAGAGAGACGCTCGAGGACAAGTTCAACAAACTCAGGATCGAGCACGAGGCACGCAGCGCGGAG
CTCGACGCCGCCACGAAGCGTCTCAGGGACGCCGAAGAACTGGCCGAAAAACACGTCAACGAGGCAAGGACACAT
CGCCAGGCCGTCATATCCGGGCTAGACAAGATATCCGCTCGGGACATGCCTCAGGCCGTCAAGGCAGATTCCGAG
CGCCTCGCCGCCCTACAGAACCAGATCGTCACTTCGAACGCCCTGGTCAAGAAGTACAAGGAGGAGGCAGACGCG
GCGGCCGACAAGTTGCGCAGTGCCGAGGAGCGCATTGCCGGGCTGGAGCAGTACCAAGAGCAGTCCAGCCGAGAG
GGCGTCGCTATAAGACGACAGCTGCAGTCGTCGCTGAGAGAGGTGCAGAGCCTGCAAGCCGCGCACTCGGACATC
CGGAACCAGCTGGCGGCGCAGCAGCTCGAGACCAACGCCATGACGGTGCAGAACAATGCGCTCAAGGACATACTG
GACGAGCGCGGCATCAGCCCGACGAGTGCGGTGCGGGCGCGCGCCCTGGCCAGCCCGCGGACCACGTCTCCGGAA
CAGACCCGGCTGCGGGAGCTCGAATCGCAGCTCGCCAGCGCCAGCGCGGCACACGAGGAAACGAGACAGGTGTTC
GCGGCCCAGGCCCAGGAATCGGAGCTCGCGTACCGTGAGAAGCTTGCGCAGCTCGAGAGCGACTATCAATCGGCC
GTGCACTACGTCAAGGGGACCGAAAAGATGCTGAAGCAGCTGAAGGACCAGCTCACGCGCTACAAGACGGACAAC
GGCCGCCTCAAGGCCGAGATTGAGGAGCTCGAGAATCGCTTGGAGGGTGGGGCCGGAGACCGGTCGGCCTCCTCG
GCGGACCTGGAGAGCGAGCGCAGCGGCTTCCAGAGGAGGATCGAAGAGCTCGAGGCCAAGCTCCGGGGCTCGGGG
GCGCAGCTGGAAAAGGACGTGCAGTCGCTCAGGACAGAGCTGGTCGAAAGCAAGCGGCAGCGGGACGAGGCGCTC
AGGAGCAGCGAGGAGGCCGCCAGGAGCCTGAACCTGCATCGCAAGGACCTCGAGCAGCTGCAGTCGGAAAATTCG
CTGCTCGAGCAGCGCGCGACGGACGCGGAGCAGAAGGTGTCGCTGCTGCTGGACCAGGTGGAAAACTCGGTGGAC
AGCTACCGCCGACGCAGCCGCCAAATCGCCAGCCTCAACTCGGAGGGCGTCGGGGGCTCCAACGGGCTCGAGCTG
GGCCACGCCCGGCACGAGAGCACGGACACGGTGAGCGCGTACGGCGGCAACGGGCTGGACGCGAGGAACAGCGCC
GCACTGGACAACCTGGCGACGGAGCTGGAGACGCTGCGCAGCCACTGGGAGGCGACCAACAAGAACTACCGGCTG
AGCTCCAACTTCGACTTCGACCAGCCGGCCGTCGGCAAGGAGGAAAGCGAGGGCGCCGCCAGCCTCGGCCTGAGC
AAGAGCTTGGCCGACTGGCGAAAGAGGCTGGACACGGACGACGCGCCGCACACCGGCGCAGACAAGCCGCACCCG
AGCTGA
Gene >Hirsu2|7993
ATGGCCTTTCTCTTCAAGTCCAAGAAGAGCCAGGACCGCGCCTTGGCCAGCCGCGACGGCAACTCGGCGGCCCAA
ACCCCCGTCCAGCCTGCCCGCATCGCCCGCGATGAAAAGACTGCAGCGCAGCAGCGCGCCACGCCCACCGGGAGC
CTCAACTCCCTGGAAAACGACGCTGCCGCCGCCAGTCCCGAGCAGGGCCATGGACGTCGCGGTGGCAGCGTCGAC
ACAACCCAACAGCAAAGCGATCTACCGGTAAGCAGCCTCCCGTCTCGTCCTCCTCCTCCTCCTCCTCCTCCTCCT
CCCCCTCTTCTTCTTCTTCCTTCTCCTGCTCCCCCTTCCTCCTCCTTCGCCTCCCCCTCCTCCCGCTCAGGAGGC
TGCCTTCCGAGCAAGCCCACCTTCTCTCCGCCGCCCTCTGACCTAGAGCCCGACAGCTCCGCAACGGACTGCAGT
CGACGAATCCGAACGCCTCGCTCTATCCTTGGTCGCAGCGGCGCCTGACCTACCCCTCGTCGAGTTCGGGCCCCT
TCCCCCGATATGGCGCCGCCGTCAACGCGACCTCTTCCAAGGAGGGCGACGTCTACATGATGGGCGGCCTGATCA
ACAGCTCGACCGTCAGGGGTGACCTCTGGATGATTGAGGCCGGCGGCAACATGTCTTGCTACCCGTTGGCAACGA
CGGCCGAGGGCCCGGGGCCGAGAGTCGGACACGCCAGCTTGCTGGTCGGCAACGCCTTCATCGTCTACGGTGGCG
ACACCAAGATCGAGGACTCCGACGTCTTGGACGAGACGCTCTACCTTCTCAACACCTGTAAGTGACGGCTGCCCG
TGCCAACATGGCGCGATTCTCGCCTTGTAGCTAACCGAGGGGCCTACAGCAACACGGAATTGGTCGCGTGCCCTC
CCCGCCGGTCCTCGCCCGTCCGGCCGCTATGGACACTCGCTTAACATTCTAGGGTCCAAAATCTACATCTTTGGC
GGCCAGGTCGAGGGCTTTTTCATGAACGATCTCTCCGCCTTTGATCTGAACCAGCTGCAGATGCCCAACAACCGG
TGGGAGATACTAATGCAGGGCGATGCCTCGCCCAAGATCCCCGCCGCCCGAACCAACCACTCTATGGTCACGTAC
AACGACAAGATGTTCTTGTAAGCCTCCTGGAGCCCCCCTTGCTACCCCCTTGACTAACCGCGCCAGGTTCGGTGG
CACCAATGGATTCCAATGGTTCAACGACGTCTGGTGCTACGATCCGGCTGTCAACTCGTGGTCGCAATTGGACTG
CATCGGCTACATCCCCGCCCCTCGCGAGGGACACGCGGCTGCGATCATCGAAGATGTCATGTATGTATTCGGTGG
TCGCACCGAGGAAGGCAGCGACTTGGGGGACCTGGCCGCCTTCCGGATATCCTCGAGACGGTGGTACACGTTTCA
AAACATGGGGCCCTCCCCATCGCCTCGGTCCGGCCACAGCATGACGACGGTAGGCAAGTTGATCGTCGTCTTGGG
CGGCGAACCCAGTGCTGCCTCCACCGCCGTCAACGATCTCGGCATACTCTACGTTCTGGATACGGCTAAGATCCG
GTATCCCAACGACAGTCAGCAGAGCTCGCAGCAGAGGGCTGTTCAGGGCCGCCGGCCGAGTGGAAGCGATGTTCA
TAGCCCCGTTCGTCAGCTGCAGTCTCGCGATGGCGCAACGGGACCTCCGGATCCTCGCAAACTGACTGGTGCTCC
AGCCCCCGTGAACGGCCCCCCGACCGCATACAAGCCGACGCCACCGGGTGGCCCCGACGTCAACGGACCGCCGCA
CCAAGGGGCTCCCGGAGCGGCGACGGCGAAGGCGTCCCGTTCGGCCATGGTCTCGAGTCCGGCCGGCCCGCCGCC
ACAGGGGCCGACTCCGGCAAAGCCTACGGGGGTCGTGTCCAGCGCCGGACGAGTCCGTGGCCCTTCCGCCGATCG
GAATGGCGTCCCGGGCTCCCCACCGACCAGATCGGTCCAGTCTCCCGTTGGCCGCGACGGCGGGATCGAGAACGA
TGCTGGCGCCGTCAACGGTCGGCGAACGCCGACACAGCCAGTGGCCCGACCCTCCAAGCCCGAGTCTGGCGCGGC
CGATCCGGCCAAAGCGAAGCAGGCCCGCCACGGGCAGTCTCAGGGCTCCGTCGACACCTCGGCGGACAGGGCGCA
GCGACCGTCCTCGCCCCCTCCTCCGACCCGTCAATCGAGCAATCCAGTGTCGAGACGCCTGTCCGGCCGCAACTC
CCAGACCGTCGCCCTTCTCAAAGAGCTAGATTCCGCACGGAATAGGAACGCTTGGTATGCTTCCGAGCTAGAGCT
GGCTCGAAAGGCAGGATACGTCTCTACCGCCGGCTTCAGCCCTACCCTCGAGGCCAAGGTGACTGAATCATTCGA
TGACGAAGATCGCCCCCTCGTCGAGGCCCTGCTGGCGATGCGGACCGAGCTGGCAAACGTGCAGAGCGCTGTTGA
CAAGCAGGCAGTCACCGCCGCGAAGCAGATCGCCGAGGCAGAAAAGCAGCGGGACGCCGCCATCCAGGAGGCAGT
CTACGCCAAAGCCAAGATGACCGCTCACGTCGGCGGAAGCGGGAGGAGCACCGCCCAGTCGGACGGCGACCCGGG
TGGCATGGGCGACAGAGCCGGCGAGATGAACCGCAAGCTCGCCTCCGCCTTGCACGCTCAAAAGGACCTGCAGTC
GCGGCTGGACGGCATGACGGCCGAGTTGGAGGCCGAGAGGAGGGCTCGGAAGCTTGCGGACGATACGACGTCGGC
AGCACAGAAGCGCATGACCGATCTTGAAGCCTACAAACAGCAGACGTCGACCGAGGTGGAGCGGCTTAAGGCGGA
GCTGCACCTCGTACAACGCGAAGCTCGCGAGCAGTCTGTCTCCAGTGCGGAGGCCATTGCATCATTGGAGCTGTT
GAGGGTAGAAAAGGCTGAGATGGCCTCCAGGTACGACGAGGCGATGGGAAGCTCAAGGGAGCACAACGAAACGTT
CGAGTCCCTCAGGAGCGCCATAGTGGCCTCCCAAGACGCCAGAGCACACCTGGAGAAGAAACTGGAGGAGGAACG
GCTGCAGAGAGAGACGCTCGAGGACAAGTTCAACAAACTCAGGATCGAGCACGAGGCACGCAGCGCGGAGCTCGA
CGCCGCCACGAAGCGTCTCAGGGACGCCGAAGAACTGGCCGAAAAACACGTCAACGAGGCAAGGACACATCGCCA
GGCCGTCATATCCGGGCTAGACAAGATATCCGCTCGGGACATGCCTCAGGCCGTCAAGGCAGATTCCGAGCGCCT
CGCCGCCCTACAGAACCAGATCGTCACTTCGAACGCCCTGGTCAAGAAGTACAAGGAGGAGGCAGACGCGGCGGC
CGACAAGTTGCGCAGTGCCGAGGAGCGCATTGCCGGGCTGGAGCAGTACCAAGAGCAGTCCAGCCGAGAGGGCGT
CGCTATAAGACGACAGCTGCAGTCGTCGCTGAGAGAGGTGCAGAGCCTGCAAGCCGCGCACTCGGACATCCGGAA
CCAGCTGGCGGCGCAGCAGCTCGAGACCAACGCCATGACGGTGCAGAACAATGCGCTCAAGGACATACTGGACGA
GCGCGGCATCAGCCCGACGAGTGCGGTGCGGGCGCGCGCCCTGGCCAGCCCGCGGACCACGTCTCCGGAACAGAC
CCGGCTGCGGGAGCTCGAATCGCAGCTCGCCAGCGCCAGCGCGGCACACGAGGAAACGAGACAGGTGTTCGCGGC
CCAGGCCCAGGAATCGGAGCTCGCGTACCGTGAGAAGCTTGCGCAGCTCGAGAGCGACTATCAATCGGCCGTGCA
CTACGTCAAGGGGACCGAAAAGATGCTGAAGCAGCTGAAGGACCAGCTCACGCGCTACAAGACGGACAACGGCCG
CCTCAAGGCCGAGATTGAGGAGCTCGAGAATCGCTTGGAGGGTGGGGCCGGAGACCGGTCGGCCTCCTCGGCGGA
CCTGGAGAGCGAGCGCAGCGGCTTCCAGAGGAGGATCGAAGAGCTCGAGGCCAAGCTCCGGGGCTCGGGGGCGCA
GCTGGAAAAGGACGTGCAGTCGCTCAGGACAGAGCTGGTCGAAAGCAAGCGGCAGCGGGACGAGGCGCTCAGGAG
CAGCGAGGAGGCCGCCAGGAGCCTGAACCTGCATCGCAAGGACCTCGAGCAGCTGCAGTCGGAAAATTCGCTGCT
CGAGCAGCGCGCGACGGACGCGGAGCAGAAGGTGTCGCTGCTGCTGGACCAGGTGGAAAACTCGGTGGACAGCTA
CCGCCGACGCAGCCGCCAAATCGCCAGCCTCAACTCGGAGGGCGTCGGGGGCTCCAACGGGCTCGAGCTGGGCCA
CGCCCGGCACGAGAGCACGGACACGGTGAGCGCGTACGGCGGCAACGGGCTGGACGCGAGGAACAGCGCCGCACT
GGACAACCTGGCGACGGAGCTGGAGACGCTGCGCAGCCACTGGGAGGCGACCAACAAGAACTACCGGCTGAGCTC
CAACTTCGACTTCGACCAGCCGGCCGTCGGCAAGGAGGAAAGCGAGGGCGCCGCCAGCCTCGGCCTGAGCAAGAG
CTTGGCCGACTGGCGAAAGAGGCTGGACACGGACGACGCGCCGCACACCGGCGCAGACAAGCCGCACCCGAGCTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail