Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7989
Gene name
LocationContig_497:15731..16821
Strand-
Gene length (bp)1090
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05368 NmrA NmrA-like family 1.7E-12 20 124
PF13460 NAD_binding_10 NAD(P)H-binding 8.3E-12 24 109
PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain 7.1E-06 19 112
PF01370 Epimerase NAD dependent epimerase/dehydratase family 5.3E-06 21 86

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0050662 coenzyme binding Yes
GO:0051287 NAD binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0003824 catalytic activity Yes
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor Yes
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7989
MQTKYAKDQPAGFTNRIERVAIVGASGQVGSHMVAALLSTGKHTVTAITRHGGGNTMPEGVKVATVDYDNEDTLV
EALRGQQFLAISLSVRAAPDTQSKIIRAAAKAGVPWVMPNCYGTDVRNASLAAENLTGPGVLGGIEAIEKEGVSS
WVAMCCSFWYEFSLAMGPGWYGFDFEKRQVTFNDDGKTRINTSTWEQCGRAIKGLLSLKELPDDEADTSPTLSRW
RNQPLYISSFLVSQRDMLDSVNRVLGTSDADWKIEHEESQARYKRGMEMLKQGSMLGFGIALYTRTFYPNGDGNF
EAKHGLANDALGLPKEDLDEATKRAVGMIKGGFKNPVA*
Coding >Hirsu2|7989
ATGCAGACAAAGTACGCAAAGGACCAGCCTGCGGGCTTCACCAACCGCATCGAGCGCGTGGCCATCGTCGGTGCC
AGCGGCCAGGTGGGCAGCCATATGGTGGCCGCGCTGCTGTCGACAGGCAAGCACACCGTCACGGCCATCACACGC
CACGGCGGCGGCAACACGATGCCCGAGGGCGTCAAGGTCGCGACGGTCGATTACGACAACGAGGACACGCTGGTC
GAAGCGCTCCGCGGCCAGCAGTTCCTCGCCATCTCCCTCTCGGTGCGAGCGGCCCCGGACACGCAGTCCAAGATC
ATCAGGGCGGCAGCCAAAGCGGGCGTGCCGTGGGTCATGCCCAACTGCTACGGCACCGACGTCCGCAATGCGTCG
CTCGCGGCGGAGAACCTGACGGGCCCCGGCGTGCTGGGCGGCATCGAGGCCATCGAAAAGGAGGGCGTCTCGTCG
TGGGTGGCCATGTGCTGCTCGTTCTGGTACGAGTTCTCGCTCGCCATGGGCCCCGGCTGGTACGGCTTCGACTTT
GAGAAGCGCCAGGTGACGTTCAACGACGACGGCAAGACGCGCATCAACACGTCGACGTGGGAGCAGTGCGGGCGT
GCCATCAAGGGGCTGCTCAGCCTCAAGGAGCTGCCGGATGACGAGGCGGACACGTCGCCGACGCTCTCGCGCTGG
CGCAACCAGCCGCTGTACATCTCGAGCTTTCTCGTTTCGCAGCGCGACATGCTCGACAGCGTCAACCGCGTCCTC
GGCACCTCCGACGCCGACTGGAAGATCGAGCACGAGGAGAGCCAGGCGCGGTATAAGCGCGGCATGGAAATGCTG
AAGCAAGGCTCGATGCTCGGCTTCGGCATCGCCCTCTACACCCGAACCTTTTACCCCAACGGCGACGGCAACTTT
GAGGCCAAGCATGGGCTGGCCAACGACGCGTTGGGGTTGCCCAAGGAAGATCTTGACGAGGCAACCAAGAGAGCT
GTCGGGATGATAAAGGGTGGATTCAAGAATCCCGTAGCTTAG
Transcript >Hirsu2|7989
ATGCAGACAAAGTACGCAAAGGACCAGCCTGCGGGCTTCACCAACCGCATCGAGCGCGTGGCCATCGTCGGTGCC
AGCGGCCAGGTGGGCAGCCATATGGTGGCCGCGCTGCTGTCGACAGGCAAGCACACCGTCACGGCCATCACACGC
CACGGCGGCGGCAACACGATGCCCGAGGGCGTCAAGGTCGCGACGGTCGATTACGACAACGAGGACACGCTGGTC
GAAGCGCTCCGCGGCCAGCAGTTCCTCGCCATCTCCCTCTCGGTGCGAGCGGCCCCGGACACGCAGTCCAAGATC
ATCAGGGCGGCAGCCAAAGCGGGCGTGCCGTGGGTCATGCCCAACTGCTACGGCACCGACGTCCGCAATGCGTCG
CTCGCGGCGGAGAACCTGACGGGCCCCGGCGTGCTGGGCGGCATCGAGGCCATCGAAAAGGAGGGCGTCTCGTCG
TGGGTGGCCATGTGCTGCTCGTTCTGGTACGAGTTCTCGCTCGCCATGGGCCCCGGCTGGTACGGCTTCGACTTT
GAGAAGCGCCAGGTGACGTTCAACGACGACGGCAAGACGCGCATCAACACGTCGACGTGGGAGCAGTGCGGGCGT
GCCATCAAGGGGCTGCTCAGCCTCAAGGAGCTGCCGGATGACGAGGCGGACACGTCGCCGACGCTCTCGCGCTGG
CGCAACCAGCCGCTGTACATCTCGAGCTTTCTCGTTTCGCAGCGCGACATGCTCGACAGCGTCAACCGCGTCCTC
GGCACCTCCGACGCCGACTGGAAGATCGAGCACGAGGAGAGCCAGGCGCGGTATAAGCGCGGCATGGAAATGCTG
AAGCAAGGCTCGATGCTCGGCTTCGGCATCGCCCTCTACACCCGAACCTTTTACCCCAACGGCGACGGCAACTTT
GAGGCCAAGCATGGGCTGGCCAACGACGCGTTGGGGTTGCCCAAGGAAGATCTTGACGAGGCAACCAAGAGAGCT
GTCGGGATGATAAAGGGTGGATTCAAGAATCCCGTAGCTTAG
Gene >Hirsu2|7989
ATGCAGACAAAGTACGCAAAGGACCAGCCTGCGGGCTTCACCAACCGCATCGAGCGCGTGGCCATCGTCGGTGTA
AGCAGAGCGCCCGCCGAGGCGACCGGCCACGGCAGATTGGACTGACAGGGCGTCTTCGCCGAATATGCAGGCCAG
CGGCCAGGTGGGCAGCCATATGGTGGCCGCGCTGCTGTCGACAGGCAAGCACACCGTCACGGCCATCACACGCCA
CGGCGGCGGCAACACGATGCCCGAGGGCGTCAAGGTCGCGACGGTCGATTACGACAACGAGGACACGCTGGTCGA
AGCGCTCCGCGGCCAGCAGTTCCTCGCCATCTCCCTCTCGGTGCGAGCGGCCCCGGACACGCAGTCCAAGATCAT
CAGGGCGGCAGCCAAAGCGGGCGTGCCGTGGGTCATGCCCAACTGCTACGGCACCGACGTCCGCAATGCGTCGCT
CGCGGCGGAGAACCTGACGGGCCCCGGCGTGCTGGGCGGCATCGAGGCCATCGAAAAGGAGGGCGTCTCGTCGTG
GGTGGCCATGTGCTGCTCGTTCTGGTACGAGTTCTCGCTCGCCATGGGCCCCGGCTGGTACGGCTTCGACTTTGA
GAAGCGCCAGGTGACGTTCAACGACGACGGCAAGACGCGCATCAACACGTCGACGTGGGAGCAGTGCGGGCGTGC
CATCAAGGGGCTGCTCAGCCTCAAGGAGCTGCCGGATGACGAGGCGGACACGTCGCCGACGCTCTCGCGCTGGCG
CAACCAGCCGCTGTACATCTCGAGCTTTCTCGTTTCGCAGCGCGACATGCTCGACAGCGTCAACCGCGTCCTCGG
CACCTCCGACGCCGACTGGAAGATCGAGCACGAGGAGAGCCAGGCGCGGTATAAGCGCGGCATGGAAATGCTGAA
GCAAGGCTCGATGCTCGGCTTCGGCATCGCCCTCTACACCCGAACCTTTTACCCCAACGGCGACGGCAACTTTGA
GGCCAAGCATGGGCTGGCCAACGACGCGTTGGGGTTGCCCAAGGAAGATCTTGACGAGGCAACCAAGAGAGCTGT
CGGGATGATAAAGGGTGGATTCAAGAATCCCGTAGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail