Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7979
Gene name
LocationContig_496:8613..11160
Strand+
Gene length (bp)2547
Transcript length (bp)2547
Coding sequence length (bp)2547
Protein length (aa) 849

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 6.4E-21 436 711

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0AD27|YEJM_ECOLI Inner membrane protein YejM OS=Escherichia coli (strain K12) GN=yejM PE=1 SV=1 604 786 1.0E-06
sp|P0AD28|YEJM_ECOL6 Inner membrane protein YejM OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yejM PE=3 SV=1 604 786 1.0E-06
sp|P0AD29|YEJM_ECO57 Inner membrane protein YejM OS=Escherichia coli O157:H7 GN=yejM PE=3 SV=1 604 786 1.0E-06

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 31 50 19
2 60 82 22
3 102 124 22
4 139 161 22
5 238 257 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7979
MCRILSLVASTVFSSKRYLVRGAYRFHNRHFALAVAAVSALSAKLVHLFANRDALQASDLLLWGLSFFCQDVALV
LLLHMLLQSRGFASTRWLRALATTSALAVTGITLFLAGFGIAFYVVAGAELHWRNIGFAGESKSWGMLLFGLPSC
VLTFTALLGWATVLQTPLSILADLGLDCVEMPLMWLLGKLPRSWWTRPPNFIYDQLPSEGEVHLEDDDESLLRSG
KDPELVPPQRSRWLRLSVALALLALLADYVFQPAERALVFMSWTLPLVPIIDFAHSSPVLASLLSAPDTSVDWDN
LTAIGEPISLPWLLELRAYLNASLPGFDDWFEAGKEHYRADADPLKISNFNDKLLPELRGRLSKINIRHVMLIKL
ESTRKDVFPFKKDSYLWRHLAESYDNKELPEEAQSRLASLSPTANLLTGDYQDGFEHEEEKRRGGINFNNAYTTS
SYTLKSLTGTLCGLTPLFADFNEDQKHHFYQPCLPHILGALSKLVEADGPSPDNFITMGWRSTFLQPVTGLHGDQ
APQMAKIGYHEENYVNEETLLGGTGKFGVANVSHKEETYFGVPEFYINDYLWDAFESAKEKNERAFVGILTSSTH
HPYGFPGTHVHLSKNGDDLSKYINSVGYVDGWLRQVVDFLDAKGFANETLLIVLGDHGIPLAENGGTTAYGNSHE
AGFHVPMVLSHPGLPPIDVDDAVTSIQILPTILDLLVETGSLSESGARAARDLMHNYEGQSLLRPRRQASEQTGQ
GDWQFAVSNPGGSDVSVRDGRRPNLHLMIPIREDIKWALNDLQADPQEQDALASFDLDTFLTAVEARHGVEIKEW
VKEAATVTNWYVRDNHKRWRYQQ*
Coding >Hirsu2|7979
ATGTGCCGCATCCTCAGCCTGGTAGCCTCAACTGTCTTCTCCAGCAAACGATATCTCGTCCGCGGCGCCTACCGC
TTTCACAATCGCCACTTTGCCTTGGCCGTCGCGGCCGTGTCCGCCCTGAGCGCGAAGCTGGTACACCTATTCGCG
AACCGTGACGCGTTGCAAGCCTCGGACCTGCTGCTCTGGGGGCTCTCGTTCTTTTGCCAAGATGTGGCCCTCGTG
CTGCTTCTGCACATGCTGCTCCAGAGTCGGGGTTTCGCCTCGACGCGCTGGCTGCGAGCTCTCGCGACAACCTCG
GCCCTTGCCGTTACCGGCATCACCCTGTTCCTGGCCGGCTTCGGCATCGCCTTTTACGTCGTGGCGGGCGCGGAA
CTGCACTGGCGCAACATTGGCTTCGCCGGCGAATCCAAGTCGTGGGGGATGCTGCTGTTCGGGCTACCGTCGTGC
GTCCTGACATTCACCGCCTTGCTTGGCTGGGCGACAGTTCTGCAGACGCCTCTCTCCATATTGGCAGACTTGGGT
CTGGATTGTGTCGAGATGCCGCTGATGTGGCTGCTTGGCAAGCTTCCGCGGAGCTGGTGGACAAGGCCGCCGAAT
TTCATATACGATCAGCTGCCTTCCGAAGGGGAAGTGCATCTGGAGGACGATGACGAGAGCCTATTACGCTCAGGC
AAAGACCCGGAGCTGGTGCCGCCACAAAGGAGTCGGTGGCTGCGCCTGTCGGTCGCCCTCGCCCTCCTCGCCCTC
CTCGCCGACTACGTTTTCCAGCCTGCAGAGAGGGCGCTGGTCTTCATGTCGTGGACCCTGCCGCTGGTCCCCATC
ATCGACTTTGCGCACTCGTCCCCTGTTCTAGCCTCCCTGCTTTCCGCTCCCGACACCAGCGTCGACTGGGATAAT
CTCACTGCGATTGGCGAACCGATCTCTCTGCCGTGGCTTCTCGAGCTTCGTGCTTATTTGAATGCGTCGCTGCCG
GGCTTCGACGACTGGTTCGAGGCCGGAAAGGAACATTATCGCGCAGATGCGGATCCCCTCAAGATATCCAACTTC
AACGACAAGCTGCTGCCCGAGCTCCGCGGTAGGCTCTCCAAGATCAACATCCGGCACGTTATGTTGATCAAGCTC
GAATCCACAAGAAAAGACGTCTTTCCGTTCAAAAAGGATAGCTACCTCTGGAGGCACCTGGCCGAGTCCTACGAT
AACAAGGAGTTGCCTGAGGAGGCGCAGTCGAGGCTGGCATCGCTTAGTCCCACCGCGAATCTTCTCACGGGCGAC
TATCAGGATGGCTTTGAGCACGAGGAGGAGAAGCGGCGAGGCGGAATCAACTTCAACAATGCCTATACGACGAGC
AGCTATACGCTAAAGAGCCTGACCGGCACACTGTGCGGGCTGACGCCTCTCTTTGCCGATTTCAACGAGGATCAG
AAGCATCATTTTTACCAGCCATGCCTGCCGCACATCTTGGGCGCGCTGAGCAAGCTGGTCGAAGCCGATGGCCCG
TCTCCGGACAACTTTATCACCATGGGATGGAGGAGCACATTTCTGCAACCCGTGACGGGCCTGCACGGCGACCAG
GCGCCGCAGATGGCGAAGATAGGGTACCACGAGGAAAACTACGTCAACGAGGAGACCTTGCTGGGCGGCACTGGC
AAGTTTGGTGTGGCCAATGTGAGCCACAAGGAGGAGACTTACTTCGGCGTCCCGGAGTTCTACATAAACGACTAC
CTATGGGATGCCTTCGAGTCGGCCAAGGAGAAGAACGAAAGAGCGTTTGTGGGGATCCTGACGAGCTCGACGCAC
CACCCCTACGGCTTTCCAGGCACCCACGTCCACCTCAGCAAGAACGGAGACGACCTCTCCAAGTATATCAACTCT
GTCGGCTATGTCGACGGCTGGCTGCGGCAAGTCGTCGACTTCCTGGACGCGAAAGGCTTCGCCAACGAGACGCTG
CTCATCGTCCTCGGCGACCACGGCATCCCTCTGGCGGAAAACGGCGGGACGACGGCGTACGGTAACTCGCACGAG
GCCGGCTTCCACGTGCCCATGGTGCTGTCCCACCCGGGCCTGCCGCCCATCGACGTCGATGACGCCGTCACGTCC
ATCCAGATCCTGCCGACCATCCTGGACCTGCTGGTCGAGACGGGCTCGCTGTCCGAGTCAGGGGCCCGGGCCGCA
CGCGACTTGATGCACAACTACGAGGGTCAGTCCCTGCTTCGGCCGAGGCGCCAAGCATCGGAGCAAACGGGCCAG
GGGGACTGGCAGTTTGCCGTCTCGAACCCGGGCGGGTCGGATGTCTCCGTGCGCGACGGCCGACGACCAAATCTG
CACTTGATGATCCCCATCAGGGAGGACATCAAGTGGGCGCTGAACGACTTGCAAGCTGATCCTCAGGAGCAGGAC
GCACTCGCGTCGTTTGACCTCGACACTTTTTTGACGGCCGTGGAGGCCAGACATGGTGTCGAGATCAAGGAATGG
GTGAAGGAGGCCGCCACGGTGACCAACTGGTATGTTCGGGACAACCACAAGCGTTGGCGTTATCAGCAGTAG
Transcript >Hirsu2|7979
ATGTGCCGCATCCTCAGCCTGGTAGCCTCAACTGTCTTCTCCAGCAAACGATATCTCGTCCGCGGCGCCTACCGC
TTTCACAATCGCCACTTTGCCTTGGCCGTCGCGGCCGTGTCCGCCCTGAGCGCGAAGCTGGTACACCTATTCGCG
AACCGTGACGCGTTGCAAGCCTCGGACCTGCTGCTCTGGGGGCTCTCGTTCTTTTGCCAAGATGTGGCCCTCGTG
CTGCTTCTGCACATGCTGCTCCAGAGTCGGGGTTTCGCCTCGACGCGCTGGCTGCGAGCTCTCGCGACAACCTCG
GCCCTTGCCGTTACCGGCATCACCCTGTTCCTGGCCGGCTTCGGCATCGCCTTTTACGTCGTGGCGGGCGCGGAA
CTGCACTGGCGCAACATTGGCTTCGCCGGCGAATCCAAGTCGTGGGGGATGCTGCTGTTCGGGCTACCGTCGTGC
GTCCTGACATTCACCGCCTTGCTTGGCTGGGCGACAGTTCTGCAGACGCCTCTCTCCATATTGGCAGACTTGGGT
CTGGATTGTGTCGAGATGCCGCTGATGTGGCTGCTTGGCAAGCTTCCGCGGAGCTGGTGGACAAGGCCGCCGAAT
TTCATATACGATCAGCTGCCTTCCGAAGGGGAAGTGCATCTGGAGGACGATGACGAGAGCCTATTACGCTCAGGC
AAAGACCCGGAGCTGGTGCCGCCACAAAGGAGTCGGTGGCTGCGCCTGTCGGTCGCCCTCGCCCTCCTCGCCCTC
CTCGCCGACTACGTTTTCCAGCCTGCAGAGAGGGCGCTGGTCTTCATGTCGTGGACCCTGCCGCTGGTCCCCATC
ATCGACTTTGCGCACTCGTCCCCTGTTCTAGCCTCCCTGCTTTCCGCTCCCGACACCAGCGTCGACTGGGATAAT
CTCACTGCGATTGGCGAACCGATCTCTCTGCCGTGGCTTCTCGAGCTTCGTGCTTATTTGAATGCGTCGCTGCCG
GGCTTCGACGACTGGTTCGAGGCCGGAAAGGAACATTATCGCGCAGATGCGGATCCCCTCAAGATATCCAACTTC
AACGACAAGCTGCTGCCCGAGCTCCGCGGTAGGCTCTCCAAGATCAACATCCGGCACGTTATGTTGATCAAGCTC
GAATCCACAAGAAAAGACGTCTTTCCGTTCAAAAAGGATAGCTACCTCTGGAGGCACCTGGCCGAGTCCTACGAT
AACAAGGAGTTGCCTGAGGAGGCGCAGTCGAGGCTGGCATCGCTTAGTCCCACCGCGAATCTTCTCACGGGCGAC
TATCAGGATGGCTTTGAGCACGAGGAGGAGAAGCGGCGAGGCGGAATCAACTTCAACAATGCCTATACGACGAGC
AGCTATACGCTAAAGAGCCTGACCGGCACACTGTGCGGGCTGACGCCTCTCTTTGCCGATTTCAACGAGGATCAG
AAGCATCATTTTTACCAGCCATGCCTGCCGCACATCTTGGGCGCGCTGAGCAAGCTGGTCGAAGCCGATGGCCCG
TCTCCGGACAACTTTATCACCATGGGATGGAGGAGCACATTTCTGCAACCCGTGACGGGCCTGCACGGCGACCAG
GCGCCGCAGATGGCGAAGATAGGGTACCACGAGGAAAACTACGTCAACGAGGAGACCTTGCTGGGCGGCACTGGC
AAGTTTGGTGTGGCCAATGTGAGCCACAAGGAGGAGACTTACTTCGGCGTCCCGGAGTTCTACATAAACGACTAC
CTATGGGATGCCTTCGAGTCGGCCAAGGAGAAGAACGAAAGAGCGTTTGTGGGGATCCTGACGAGCTCGACGCAC
CACCCCTACGGCTTTCCAGGCACCCACGTCCACCTCAGCAAGAACGGAGACGACCTCTCCAAGTATATCAACTCT
GTCGGCTATGTCGACGGCTGGCTGCGGCAAGTCGTCGACTTCCTGGACGCGAAAGGCTTCGCCAACGAGACGCTG
CTCATCGTCCTCGGCGACCACGGCATCCCTCTGGCGGAAAACGGCGGGACGACGGCGTACGGTAACTCGCACGAG
GCCGGCTTCCACGTGCCCATGGTGCTGTCCCACCCGGGCCTGCCGCCCATCGACGTCGATGACGCCGTCACGTCC
ATCCAGATCCTGCCGACCATCCTGGACCTGCTGGTCGAGACGGGCTCGCTGTCCGAGTCAGGGGCCCGGGCCGCA
CGCGACTTGATGCACAACTACGAGGGTCAGTCCCTGCTTCGGCCGAGGCGCCAAGCATCGGAGCAAACGGGCCAG
GGGGACTGGCAGTTTGCCGTCTCGAACCCGGGCGGGTCGGATGTCTCCGTGCGCGACGGCCGACGACCAAATCTG
CACTTGATGATCCCCATCAGGGAGGACATCAAGTGGGCGCTGAACGACTTGCAAGCTGATCCTCAGGAGCAGGAC
GCACTCGCGTCGTTTGACCTCGACACTTTTTTGACGGCCGTGGAGGCCAGACATGGTGTCGAGATCAAGGAATGG
GTGAAGGAGGCCGCCACGGTGACCAACTGGTATGTTCGGGACAACCACAAGCGTTGGCGTTATCAGCAGTAG
Gene >Hirsu2|7979
ATGTGCCGCATCCTCAGCCTGGTAGCCTCAACTGTCTTCTCCAGCAAACGATATCTCGTCCGCGGCGCCTACCGC
TTTCACAATCGCCACTTTGCCTTGGCCGTCGCGGCCGTGTCCGCCCTGAGCGCGAAGCTGGTACACCTATTCGCG
AACCGTGACGCGTTGCAAGCCTCGGACCTGCTGCTCTGGGGGCTCTCGTTCTTTTGCCAAGATGTGGCCCTCGTG
CTGCTTCTGCACATGCTGCTCCAGAGTCGGGGTTTCGCCTCGACGCGCTGGCTGCGAGCTCTCGCGACAACCTCG
GCCCTTGCCGTTACCGGCATCACCCTGTTCCTGGCCGGCTTCGGCATCGCCTTTTACGTCGTGGCGGGCGCGGAA
CTGCACTGGCGCAACATTGGCTTCGCCGGCGAATCCAAGTCGTGGGGGATGCTGCTGTTCGGGCTACCGTCGTGC
GTCCTGACATTCACCGCCTTGCTTGGCTGGGCGACAGTTCTGCAGACGCCTCTCTCCATATTGGCAGACTTGGGT
CTGGATTGTGTCGAGATGCCGCTGATGTGGCTGCTTGGCAAGCTTCCGCGGAGCTGGTGGACAAGGCCGCCGAAT
TTCATATACGATCAGCTGCCTTCCGAAGGGGAAGTGCATCTGGAGGACGATGACGAGAGCCTATTACGCTCAGGC
AAAGACCCGGAGCTGGTGCCGCCACAAAGGAGTCGGTGGCTGCGCCTGTCGGTCGCCCTCGCCCTCCTCGCCCTC
CTCGCCGACTACGTTTTCCAGCCTGCAGAGAGGGCGCTGGTCTTCATGTCGTGGACCCTGCCGCTGGTCCCCATC
ATCGACTTTGCGCACTCGTCCCCTGTTCTAGCCTCCCTGCTTTCCGCTCCCGACACCAGCGTCGACTGGGATAAT
CTCACTGCGATTGGCGAACCGATCTCTCTGCCGTGGCTTCTCGAGCTTCGTGCTTATTTGAATGCGTCGCTGCCG
GGCTTCGACGACTGGTTCGAGGCCGGAAAGGAACATTATCGCGCAGATGCGGATCCCCTCAAGATATCCAACTTC
AACGACAAGCTGCTGCCCGAGCTCCGCGGTAGGCTCTCCAAGATCAACATCCGGCACGTTATGTTGATCAAGCTC
GAATCCACAAGAAAAGACGTCTTTCCGTTCAAAAAGGATAGCTACCTCTGGAGGCACCTGGCCGAGTCCTACGAT
AACAAGGAGTTGCCTGAGGAGGCGCAGTCGAGGCTGGCATCGCTTAGTCCCACCGCGAATCTTCTCACGGGCGAC
TATCAGGATGGCTTTGAGCACGAGGAGGAGAAGCGGCGAGGCGGAATCAACTTCAACAATGCCTATACGACGAGC
AGCTATACGCTAAAGAGCCTGACCGGCACACTGTGCGGGCTGACGCCTCTCTTTGCCGATTTCAACGAGGATCAG
AAGCATCATTTTTACCAGCCATGCCTGCCGCACATCTTGGGCGCGCTGAGCAAGCTGGTCGAAGCCGATGGCCCG
TCTCCGGACAACTTTATCACCATGGGATGGAGGAGCACATTTCTGCAACCCGTGACGGGCCTGCACGGCGACCAG
GCGCCGCAGATGGCGAAGATAGGGTACCACGAGGAAAACTACGTCAACGAGGAGACCTTGCTGGGCGGCACTGGC
AAGTTTGGTGTGGCCAATGTGAGCCACAAGGAGGAGACTTACTTCGGCGTCCCGGAGTTCTACATAAACGACTAC
CTATGGGATGCCTTCGAGTCGGCCAAGGAGAAGAACGAAAGAGCGTTTGTGGGGATCCTGACGAGCTCGACGCAC
CACCCCTACGGCTTTCCAGGCACCCACGTCCACCTCAGCAAGAACGGAGACGACCTCTCCAAGTATATCAACTCT
GTCGGCTATGTCGACGGCTGGCTGCGGCAAGTCGTCGACTTCCTGGACGCGAAAGGCTTCGCCAACGAGACGCTG
CTCATCGTCCTCGGCGACCACGGCATCCCTCTGGCGGAAAACGGCGGGACGACGGCGTACGGTAACTCGCACGAG
GCCGGCTTCCACGTGCCCATGGTGCTGTCCCACCCGGGCCTGCCGCCCATCGACGTCGATGACGCCGTCACGTCC
ATCCAGATCCTGCCGACCATCCTGGACCTGCTGGTCGAGACGGGCTCGCTGTCCGAGTCAGGGGCCCGGGCCGCA
CGCGACTTGATGCACAACTACGAGGGTCAGTCCCTGCTTCGGCCGAGGCGCCAAGCATCGGAGCAAACGGGCCAG
GGGGACTGGCAGTTTGCCGTCTCGAACCCGGGCGGGTCGGATGTCTCCGTGCGCGACGGCCGACGACCAAATCTG
CACTTGATGATCCCCATCAGGGAGGACATCAAGTGGGCGCTGAACGACTTGCAAGCTGATCCTCAGGAGCAGGAC
GCACTCGCGTCGTTTGACCTCGACACTTTTTTGACGGCCGTGGAGGCCAGACATGGTGTCGAGATCAAGGAATGG
GTGAAGGAGGCCGCCACGGTGACCAACTGGTATGTTCGGGACAACCACAAGCGTTGGCGTTATCAGCAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail