Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7974
Gene name
LocationContig_495:10608..10818
Strand+
Gene length (bp)210
Transcript length (bp)210
Coding sequence length (bp)210
Protein length (aa) 70

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10471 ANAPC_CDC26 Anaphase-promoting complex APC subunit CDC26 1.5E-11 1 45

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13916|HCN1_SCHPO Anaphase-promoting complex subunit hcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hcn1 PE=1 SV=1 1 64 6.0E-06

GO

GO Term Description Terminal node
GO:0005680 anaphase-promoting complex Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0030071 regulation of mitotic metaphase/anaphase transition Yes
GO:1902494 catalytic complex No
GO:0065007 biological regulation No
GO:0033045 regulation of sister chromatid segregation No
GO:0019941 modification-dependent protein catabolic process No
GO:0071704 organic substance metabolic process No
GO:1901987 regulation of cell cycle phase transition No
GO:1901565 organonitrogen compound catabolic process No
GO:0051603 proteolysis involved in cellular protein catabolic process No
GO:0044428 nuclear part No
GO:0006807 nitrogen compound metabolic process No
GO:0050794 regulation of cellular process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0044248 cellular catabolic process No
GO:0008150 biological_process No
GO:0044422 organelle part No
GO:0044260 cellular macromolecule metabolic process No
GO:0033047 regulation of mitotic sister chromatid segregation No
GO:0007346 regulation of mitotic cell cycle No
GO:0033043 regulation of organelle organization No
GO:0051783 regulation of nuclear division No
GO:0007088 regulation of mitotic nuclear division No
GO:0044265 cellular macromolecule catabolic process No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0030163 protein catabolic process No
GO:0006508 proteolysis No
GO:1901575 organic substance catabolic process No
GO:0010965 regulation of mitotic sister chromatid separation No
GO:1990234 transferase complex No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0051128 regulation of cellular component organization No
GO:0009057 macromolecule catabolic process No
GO:0000151 ubiquitin ligase complex No
GO:0032991 protein-containing complex No
GO:0000152 nuclear ubiquitin ligase complex No
GO:1902099 regulation of metaphase/anaphase transition of cell cycle No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0044424 intracellular part No
GO:0033044 regulation of chromosome organization No
GO:0009056 catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0051983 regulation of chromosome segregation No
GO:1901990 regulation of mitotic cell cycle phase transition No
GO:0050789 regulation of biological process No
GO:0010564 regulation of cell cycle process No
GO:0019538 protein metabolic process No
GO:0051726 regulation of cell cycle No
GO:0044464 cell part No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:1905818 regulation of chromosome separation No
GO:0010498 proteasomal protein catabolic process No
GO:0044237 cellular metabolic process No
GO:0044446 intracellular organelle part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7974
MLRRTPTTLAITAEDVAAYEDRRASEALLAAQAERAPQQQQQQQQPPAAPPSPRRIRDERIGVTRRAGR*
Coding >Hirsu2|7974
ATGCTGCGGCGCACGCCCACCACCCTCGCCATCACGGCCGAGGACGTCGCCGCCTACGAGGACCGCCGCGCCAGC
GAGGCCCTGCTCGCCGCCCAAGCCGAGCGCGCGCCCCAGCAGCAGCAGCAGCAGCAGCAGCCGCCGGCAGCGCCG
CCGAGCCCGCGCCGGATCCGCGACGAGAGGATCGGCGTAACGCGCCGCGCCGGCCGCTGA
Transcript >Hirsu2|7974
ATGCTGCGGCGCACGCCCACCACCCTCGCCATCACGGCCGAGGACGTCGCCGCCTACGAGGACCGCCGCGCCAGC
GAGGCCCTGCTCGCCGCCCAAGCCGAGCGCGCGCCCCAGCAGCAGCAGCAGCAGCAGCAGCCGCCGGCAGCGCCG
CCGAGCCCGCGCCGGATCCGCGACGAGAGGATCGGCGTAACGCGCCGCGCCGGCCGCTGA
Gene >Hirsu2|7974
ATGCTGCGGCGCACGCCCACCACCCTCGCCATCACGGCCGAGGACGTCGCCGCCTACGAGGACCGCCGCGCCAGC
GAGGCCCTGCTCGCCGCCCAAGCCGAGCGCGCGCCCCAGCAGCAGCAGCAGCAGCAGCAGCCGCCGGCAGCGCCG
CCGAGCCCGCGCCGGATCCGCGACGAGAGGATCGGCGTAACGCGCCGCGCCGGCCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail