Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7959
Gene name
LocationContig_493:6692..8412
Strand+
Gene length (bp)1720
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 3.6E-27 48 185
PF08031 BBE Berberine and berberine like 2.6E-13 424 467

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 39 468 8.0E-21
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 18 468 2.0E-20
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 39 468 5.0E-20
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 18 468 6.0E-20
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 14 469 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 39 468 8.0E-21
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 18 468 2.0E-20
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 39 468 5.0E-20
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 18 468 6.0E-20
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 14 469 1.0E-19
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 41 468 3.0E-19
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 49 468 3.0E-18
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 37 469 1.0E-17
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 47 218 2.0E-17
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 49 468 5.0E-17
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 39 468 8.0E-17
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 49 468 9.0E-17
sp|P30986|RETO_ESCCA Reticuline oxidase OS=Eschscholzia californica GN=BBE1 PE=1 SV=1 21 468 2.0E-16
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 1 468 2.0E-16
sp|P93479|RETO_PAPSO Reticuline oxidase OS=Papaver somniferum GN=BBE1 PE=2 SV=1 48 471 2.0E-15
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 49 468 2.0E-15
sp|Q9SVG4|RETOL_ARATH Reticuline oxidase-like protein OS=Arabidopsis thaliana GN=At4g20830 PE=1 SV=2 39 472 6.0E-15
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 5 216 7.0E-14
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 42 356 2.0E-13
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 46 356 6.0E-13
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 44 250 7.0E-13
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 115 460 2.0E-12
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 46 227 4.0E-12
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 46 227 1.0E-10
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 46 217 3.0E-10
sp|Q5Z620|CKX10_ORYSJ Cytokinin dehydrogenase 10 OS=Oryza sativa subsp. japonica GN=CKX10 PE=3 SV=1 48 227 9.0E-09
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 38 227 1.0E-08
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 9 237 1.0E-08
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 48 237 8.0E-08
sp|P46377|FAS5_RHOFA Uncharacterized oxidoreductase ORF5 in fasciation locus OS=Rhodococcus fascians GN=fas5 PE=2 SV=1 59 224 9.0E-08
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 44 227 1.0E-07
sp|Q5ZAY9|CKX5_ORYSJ Cytokinin dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=CKX5 PE=2 SV=1 47 230 2.0E-07
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 48 216 2.0E-07
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 38 251 3.0E-07
sp|Q3ZC33|GGLO_BOVIN L-gulonolactone oxidase OS=Bos taurus GN=GULO PE=2 SV=3 48 217 1.0E-06
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 44 251 1.0E-06
sp|Q8HXW0|GGLO_PIG L-gulonolactone oxidase OS=Sus scrofa GN=GULO PE=2 SV=3 48 217 3.0E-06
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 48 217 6.0E-06
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 48 226 9.0E-06
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 48 226 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.4552 0.1391 0.8784 0.2056 0.31 0.0832 0.1156 0.2897 0.0385 0.3395

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA7 1.7E-75 39 248

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3274
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7468
Ophiocordyceps camponoti-floridani Ophcf2|01056
Ophiocordyceps camponoti-rufipedis Ophun1|6672
Ophiocordyceps kimflemingae Ophio5|2376
Ophiocordyceps subramaniannii Hirsu2|5980
Ophiocordyceps subramaniannii Hirsu2|7959 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7959
MGSGHSSGLATCLDAVCNGRHACVAYPDHLLYQASWVDRYNLDIPVHPIAVTRPSNADDVSGFVKCAAANNVRVQ
AKSGGHSYANYGLGGEDGELVIDLRHLQHFSMDTNTWQATIGAGHRLWDVTHKLHENGKRAVSHGTCPGVGIGGH
ATIGGLGPSSRMWGSCLDHVVEVEVVTADGSIRRASERENADLFFALKGAGAGFGVITEFVMKTHPEPGSVVRYT
YSVNFGRHADMVDVFDQWQALISDPGLDRRFGSEIIMHAFGLVISATFHGTRDEYEASGIPDRIPRGNVSVLLDN
WLGVVGNQAQDAGLWVSEVRSSFTSRSLAFRRDQLLSRDDIVRMMDFLDRTDKGTLVWFLIFDVTGGAIGDVRTD
ATAYAHRDKIMFCQGYAVGIPALTRKTRVFMDGLISTIRETANSTLTTYPGYVDPSLHDAQASYWGPNLPRLTEV
KTKWDPQDVFHNPQSVRPSGKD*
Coding >Hirsu2|7959
ATGGGCAGCGGGCACAGCTCCGGGCTGGCGACGTGCCTCGACGCCGTCTGCAACGGCCGCCACGCCTGTGTCGCA
TACCCGGACCACCTTCTCTACCAGGCCTCCTGGGTTGACCGGTACAATCTCGACATCCCCGTGCATCCGATTGCC
GTGACGAGGCCCAGCAATGCCGACGACGTGTCCGGCTTTGTCAAGTGCGCGGCCGCCAACAACGTCAGGGTCCAA
GCCAAGTCCGGCGGCCACTCGTATGCCAACTATGGACTGGGAGGAGAGGACGGCGAGCTCGTCATCGACCTGCGC
CATCTCCAACACTTCTCCATGGACACCAACACGTGGCAGGCCACCATCGGCGCCGGCCACCGCCTATGGGACGTC
ACCCACAAGCTGCATGAGAACGGCAAACGGGCCGTCTCCCACGGGACATGTCCCGGGGTCGGCATCGGCGGCCAC
GCCACCATCGGAGGCCTGGGCCCGTCTTCCAGGATGTGGGGGTCGTGCCTTGACCACGTTGTCGAGGTCGAGGTC
GTGACGGCGGACGGGAGCATCCGGCGCGCGAGCGAGCGGGAGAACGCCGACCTGTTCTTCGCTCTCAAGGGCGCC
GGGGCCGGCTTCGGCGTCATCACCGAGTTCGTCATGAAGACGCACCCGGAGCCCGGCAGCGTGGTGCGGTACACG
TACTCGGTCAACTTCGGCCGGCACGCCGACATGGTCGACGTCTTCGACCAGTGGCAGGCCCTCATCTCGGACCCG
GGCCTCGACCGCCGCTTCGGCTCCGAGATCATCATGCACGCCTTCGGCCTCGTCATCTCGGCCACCTTCCACGGC
ACGCGCGACGAGTATGAGGCCAGCGGCATCCCCGACCGCATCCCGCGCGGTAACGTCTCTGTCCTCCTCGACAAC
TGGCTCGGCGTCGTCGGCAACCAGGCCCAGGACGCCGGTCTCTGGGTCTCCGAGGTCCGCAGCAGCTTCACCTCG
CGCAGCCTGGCCTTCCGCAGGGACCAGCTGCTGTCGCGCGACGACATCGTCCGCATGATGGATTTCCTCGACCGC
ACCGACAAGGGCACCTTGGTGTGGTTCCTCATCTTCGACGTCACCGGCGGCGCCATCGGCGACGTCCGCACCGAT
GCCACCGCCTACGCCCACCGCGACAAGATCATGTTCTGCCAGGGCTACGCCGTCGGCATCCCGGCCCTGACGCGC
AAGACCCGTGTCTTCATGGACGGCCTGATCTCGACCATCCGCGAAACGGCCAACTCGACCCTGACCACCTACCCG
GGCTACGTCGACCCGTCCCTGCACGACGCCCAAGCCTCGTACTGGGGGCCCAACTTGCCGAGGCTCACCGAGGTC
AAGACCAAGTGGGATCCGCAAGACGTCTTCCACAACCCGCAGAGCGTGCGCCCGTCCGGCAAGGACTGA
Transcript >Hirsu2|7959
ATGGGCAGCGGGCACAGCTCCGGGCTGGCGACGTGCCTCGACGCCGTCTGCAACGGCCGCCACGCCTGTGTCGCA
TACCCGGACCACCTTCTCTACCAGGCCTCCTGGGTTGACCGGTACAATCTCGACATCCCCGTGCATCCGATTGCC
GTGACGAGGCCCAGCAATGCCGACGACGTGTCCGGCTTTGTCAAGTGCGCGGCCGCCAACAACGTCAGGGTCCAA
GCCAAGTCCGGCGGCCACTCGTATGCCAACTATGGACTGGGAGGAGAGGACGGCGAGCTCGTCATCGACCTGCGC
CATCTCCAACACTTCTCCATGGACACCAACACGTGGCAGGCCACCATCGGCGCCGGCCACCGCCTATGGGACGTC
ACCCACAAGCTGCATGAGAACGGCAAACGGGCCGTCTCCCACGGGACATGTCCCGGGGTCGGCATCGGCGGCCAC
GCCACCATCGGAGGCCTGGGCCCGTCTTCCAGGATGTGGGGGTCGTGCCTTGACCACGTTGTCGAGGTCGAGGTC
GTGACGGCGGACGGGAGCATCCGGCGCGCGAGCGAGCGGGAGAACGCCGACCTGTTCTTCGCTCTCAAGGGCGCC
GGGGCCGGCTTCGGCGTCATCACCGAGTTCGTCATGAAGACGCACCCGGAGCCCGGCAGCGTGGTGCGGTACACG
TACTCGGTCAACTTCGGCCGGCACGCCGACATGGTCGACGTCTTCGACCAGTGGCAGGCCCTCATCTCGGACCCG
GGCCTCGACCGCCGCTTCGGCTCCGAGATCATCATGCACGCCTTCGGCCTCGTCATCTCGGCCACCTTCCACGGC
ACGCGCGACGAGTATGAGGCCAGCGGCATCCCCGACCGCATCCCGCGCGGTAACGTCTCTGTCCTCCTCGACAAC
TGGCTCGGCGTCGTCGGCAACCAGGCCCAGGACGCCGGTCTCTGGGTCTCCGAGGTCCGCAGCAGCTTCACCTCG
CGCAGCCTGGCCTTCCGCAGGGACCAGCTGCTGTCGCGCGACGACATCGTCCGCATGATGGATTTCCTCGACCGC
ACCGACAAGGGCACCTTGGTGTGGTTCCTCATCTTCGACGTCACCGGCGGCGCCATCGGCGACGTCCGCACCGAT
GCCACCGCCTACGCCCACCGCGACAAGATCATGTTCTGCCAGGGCTACGCCGTCGGCATCCCGGCCCTGACGCGC
AAGACCCGTGTCTTCATGGACGGCCTGATCTCGACCATCCGCGAAACGGCCAACTCGACCCTGACCACCTACCCG
GGCTACGTCGACCCGTCCCTGCACGACGCCCAAGCCTCGTACTGGGGGCCCAACTTGCCGAGGCTCACCGAGGTC
AAGACCAAGTGGGATCCGCAAGACGTCTTCCACAACCCGCAGAGCGTGCGCCCGTCCGGCAAGGACTGA
Gene >Hirsu2|7959
ATGGGCAGCGGGCACAGCTCCGGGCTGGCGACGTGCCTCGACGCCGTCTGCAACGGCCGCCACGCCTGTGTCGCA
TACCCGGACCACCTTCTCTACCAGGCCTCCTGGGTTGACCGGTACAATCTCGACATCCCCGTGCATCCGATTGCC
GTGACGAGGCCCAGCAATGCCGACGACGTGTCCGGCTTTGTCAAGTGCGCGGCCGCCAACAACGTCAGGGTCCAA
GCCAAGTCCGGCGGCCACTCGTATGCGTATGTCTCTCTCCGCCCGTATCGTATCCATGACCCCTCGACTCTCGTC
TCCCGGCTTCTGCCTGCCTCGTCGACGTGCTGAGCGCTGACGCGACCACTTCAAGCAACTATGGTGAGTTCGACT
GGGGCTCGCAAGCCTCATCCTGCACACGCCCAACGCTGACGCGCGGGCCGCAGGACTGGGAGGAGAGGACGGCGA
GCTCGTCATCGACCTGCGCCATCTCCAACACTTCTCCATGGACACCAACACGTGGCAGGCCACCATCGGCGCCGG
CCACCGCCTATGGGACGTCACCCACAAGCTGCATGAGAACGGCAAACGGGCCGTCTCCCACGGGACATGTCCCGG
GGTCGGCATCGGCGGCCACGCCACCATCGTGAGTCGCGTTACGGTCTCAGAGGGGGGCCGAGGTCGAGCCGTGCT
GATTCCAGACCCAAAGGGAGGCCTGGGCCCGTCTTCCAGGATGTGGGGGTCGTGCCTTGACCACGTTGTCGAGGT
CGAGGTCGTGACGGCGGACGGGAGCATCCGGCGCGCGAGCGAGCGGGAGAACGCCGACCTGTTCTTCGTAAGTCT
TCGTCTTCTTCACCCGCTCAAGGCCCGTCACACCGGACGGCTGACCCCGGGAGGCGCACAGGCTCTCAAGGGCGC
CGGGGCCGGCTTCGGCGTCATCACCGAGTTCGTCATGAAGACGCACCCGGAGCCCGGCAGCGTGGTGCGGTACAC
GTACTCGGTCAACTTCGGCCGGCACGCCGACATGGTCGACGTCTTCGACCAGTGGCAGGCCCTCATCTCGGACCC
GGGCCTCGACCGCCGCTTCGGCTCCGAGATCATCATGCACGCCTTCGGCCTCGTCATCTCGGCCACCTTCCACGG
CACGCGCGACGAGTATGAGGCCAGCGGCATCCCCGACCGCATCCCGCGCGGTAACGTCTCTGTCCTCCTCGACAA
CTGGCTCGGCGTCGTCGGCAACCAGGCCCAGGACGCCGGTCTCTGGGTCTCCGAGGTCCGCAGCAGCTTCACCTC
GCGCAGCCTGGCCTTCCGCAGGGACCAGCTGCTGTCGCGCGACGACATCGTCCGCATGATGGATTTCCTCGACCG
CACCGACAAGGGCACCTTGGTGTGGTTCCTCATCTTCGACGTCACCGGCGGCGCCATCGGCGACGTCCGCACCGA
TGCCACCGCCTACGCCCACCGCGACAAGATCATGTTCTGCCAGGGCTACGCCGTCGGCATCCCGGCCCTGACGCG
CAAGACCCGTGTCTTCATGGACGGCCTGATCTCGACCATCCGCGAAACGGCCAACTCGACCCTGACCACCTACCC
GGGCTACGTCGACCCGTCCCTGCACGACGCCCAAGCCTCGTACTGGGGGCCCAACTTGCCGAGGCTCACCGAGGT
CAAGACCAAGTGGGATCCGCAAGACGTCTTCCACAACCCGCAGAGCGTGCGCCCGTCCGGCAAGGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail