Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7955
Gene name
LocationContig_492:12158..12685
Strand-
Gene length (bp)527
Transcript length (bp)465
Coding sequence length (bp)465
Protein length (aa) 155

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08523 MBF1 Multiprotein bridging factor 1 9.5E-25 5 79
PF01381 HTH_3 Helix-turn-helix 2.5E-10 89 141

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q53IP3|MBF1_GIBFU Multiprotein-bridging factor 1 OS=Gibberella fujikuroi GN=MBF1 PE=3 SV=1 5 154 9.0E-83
sp|Q4WX89|MBF1_ASPFU Multiprotein-bridging factor 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mbf1 PE=3 SV=1 5 154 1.0E-64
sp|Q5B8Y4|MBF1_EMENI Multiprotein-bridging factor 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mbf1 PE=3 SV=1 5 154 2.0E-62
sp|Q871W6|MBF1_NEUCR Multiprotein-bridging factor 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mbf-1 PE=3 SV=1 5 146 5.0E-54
sp|Q6BXQ8|MBF1_DEBHA Multiprotein-bridging factor 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MBF1 PE=3 SV=1 1 154 9.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q53IP3|MBF1_GIBFU Multiprotein-bridging factor 1 OS=Gibberella fujikuroi GN=MBF1 PE=3 SV=1 5 154 9.0E-83
sp|Q4WX89|MBF1_ASPFU Multiprotein-bridging factor 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mbf1 PE=3 SV=1 5 154 1.0E-64
sp|Q5B8Y4|MBF1_EMENI Multiprotein-bridging factor 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mbf1 PE=3 SV=1 5 154 2.0E-62
sp|Q871W6|MBF1_NEUCR Multiprotein-bridging factor 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mbf-1 PE=3 SV=1 5 146 5.0E-54
sp|Q6BXQ8|MBF1_DEBHA Multiprotein-bridging factor 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MBF1 PE=3 SV=1 1 154 9.0E-43
sp|Q8TG23|MBF1_YARLI Putative multi-protein-binding factor 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MBF1 PE=3 SV=1 1 154 7.0E-41
sp|O14467|MBF1_YEAST Multiprotein-bridging factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MBF1 PE=1 SV=2 1 154 2.0E-39
sp|Q6CIP4|MBF1_KLULA Multiprotein-bridging factor 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MBF1 PE=3 SV=2 1 148 1.0E-38
sp|Q6FJN0|MBF1_CANGA Multiprotein-bridging factor 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MBF1 PE=3 SV=1 5 148 3.0E-38
sp|Q752P7|MBF1_ASHGO Multiprotein-bridging factor 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MBF1 PE=3 SV=1 1 148 4.0E-38
sp|Q5A940|MBF1_CANAL Multiprotein-bridging factor 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MBF1 PE=3 SV=1 1 154 1.0E-37
sp|O94700|MBF1_SCHPO Multiprotein-bridging factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mbf1 PE=3 SV=1 5 148 2.0E-35
sp|Q52BY4|MBF1_MAGO7 Multiprotein-bridging factor 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MBF1 PE=3 SV=1 1 154 2.0E-25
sp|P0CO30|MBF1_CRYNJ Multiprotein-bridging factor 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MBF1 PE=3 SV=1 5 154 2.0E-24
sp|P0CO31|MBF1_CRYNB Multiprotein-bridging factor 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MBF1 PE=3 SV=1 5 154 2.0E-24
sp|Q6GPQ6|EDF1_XENLA Endothelial differentiation-related factor 1 homolog OS=Xenopus laevis GN=edf1 PE=2 SV=1 5 151 8.0E-23
sp|O60869|EDF1_HUMAN Endothelial differentiation-related factor 1 OS=Homo sapiens GN=EDF1 PE=1 SV=1 5 148 4.0E-21
sp|Q3T0V7|EDF1_BOVIN Endothelial differentiation-related factor 1 OS=Bos taurus GN=EDF1 PE=2 SV=1 5 148 4.0E-21
sp|P69736|EDF1_RAT Endothelial differentiation-related factor 1 OS=Rattus norvegicus GN=Edf1 PE=1 SV=1 5 148 5.0E-21
sp|Q9JMG1|EDF1_MOUSE Endothelial differentiation-related factor 1 OS=Mus musculus GN=Edf1 PE=1 SV=1 5 148 5.0E-21
sp|Q5ZMC0|EDF1_CHICK Endothelial differentiation-related factor 1 homolog OS=Gallus gallus GN=EDF1 PE=2 SV=1 5 148 2.0E-20
sp|Q6PBY3|EDF1_DANRE Endothelial differentiation-related factor 1 homolog OS=Danio rerio GN=edf1 PE=2 SV=1 5 148 7.0E-18
sp|P14327|VSH7_DICDI Vegetative-specific protein H7 OS=Dictyostelium discoideum GN=cinD-1 PE=2 SV=2 67 148 1.0E-12
sp|Q9LV58|MBF1C_ARATH Multiprotein-bridging factor 1c OS=Arabidopsis thaliana GN=MBF1C PE=1 SV=1 1 142 3.0E-12
sp|Q9LXT3|MBF1B_ARATH Multiprotein-bridging factor 1b OS=Arabidopsis thaliana GN=MBF1B PE=2 SV=1 1 142 4.0E-12
sp|Q9SJI8|MBF1A_ARATH Multiprotein-bridging factor 1a OS=Arabidopsis thaliana GN=MBF1A PE=2 SV=1 28 142 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0003677 DNA binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-turn-helix

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7955
MSEGWDNVTKIGSKVRGPGAAERETVVRGKAALNAAQRSGGIVATEKKYSSANATGSSTEGQRLTKVDRSDDIIK
PNTVGKAVGDAISAARQKMEPKMTQKDLATRCNTTQSVVADFERGTATPDQKVLGAMERVLKVKLRGNDIGAPRF
PTKK*
Coding >Hirsu2|7955
ATGTCTGAAGGCTGGGACAACGTCACCAAGATCGGCAGCAAGGTGCGCGGCCCCGGCGCTGCCGAGCGGGAGACT
GTCGTGCGAGGCAAGGCTGCTCTGAATGCGGCCCAGCGGAGCGGCGGCATCGTCGCGACGGAGAAGAAATACTCT
TCGGCGAATGCGACCGGCAGCTCGACCGAGGGTCAGCGCCTGACCAAGGTCGACCGGTCCGACGACATCATCAAG
CCCAACACGGTCGGCAAGGCTGTCGGCGATGCCATCTCGGCCGCGCGCCAGAAGATGGAGCCCAAGATGACGCAG
AAGGATCTGGCCACCAGGTGCAACACCACCCAGTCCGTCGTCGCCGACTTCGAGCGAGGCACCGCCACGCCTGAC
CAGAAAGTGCTCGGCGCCATGGAGCGTGTGCTCAAGGTCAAGCTGCGAGGCAACGACATTGGCGCTCCCCGGTTC
CCGACCAAGAAGTGA
Transcript >Hirsu2|7955
ATGTCTGAAGGCTGGGACAACGTCACCAAGATCGGCAGCAAGGTGCGCGGCCCCGGCGCTGCCGAGCGGGAGACT
GTCGTGCGAGGCAAGGCTGCTCTGAATGCGGCCCAGCGGAGCGGCGGCATCGTCGCGACGGAGAAGAAATACTCT
TCGGCGAATGCGACCGGCAGCTCGACCGAGGGTCAGCGCCTGACCAAGGTCGACCGGTCCGACGACATCATCAAG
CCCAACACGGTCGGCAAGGCTGTCGGCGATGCCATCTCGGCCGCGCGCCAGAAGATGGAGCCCAAGATGACGCAG
AAGGATCTGGCCACCAGGTGCAACACCACCCAGTCCGTCGTCGCCGACTTCGAGCGAGGCACCGCCACGCCTGAC
CAGAAAGTGCTCGGCGCCATGGAGCGTGTGCTCAAGGTCAAGCTGCGAGGCAACGACATTGGCGCTCCCCGGTTC
CCGACCAAGAAGTGA
Gene >Hirsu2|7955
ATGTCTGAAGGCTGGGACAACGTCACCAAGATCGGCAGCAAGGTGCGCGGCCCCGGCGCTGCCGAGCGGGAGACT
GTCGTGCGAGGCAAGGCTGCTCTGAATGCGGCCCAGCGGAGCGGCGGCATCGTCGCGACGGAGAAGAAATACTCT
TCGGCGAATGCGGTACGTATGGGACGGGGGAGCGCATAGGCGTCCGATCTGACCTGGGCTGTGCCCTCCTGCAGA
CCGGCAGCTCGACCGAGGGTCAGCGCCTGACCAAGGTCGACCGGTCCGACGACATCATCAAGCCCAACACGGTCG
GCAAGGCTGTCGGCGATGCCATCTCGGCCGCGCGCCAGAAGATGGAGCCCAAGATGACGCAGAAGGATCTGGCCA
CCAGGTGCAACACCACCCAGTCCGTCGTCGCCGACTTCGAGCGAGGCACCGCCACGCCTGACCAGAAAGTGCTCG
GCGCCATGGAGCGTGTGCTCAAGGTCAAGCTGCGAGGCAACGACATTGGCGCTCCCCGGTTCCCGACCAAGAAGT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail