Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7953
Gene name
LocationContig_492:8802..9881
Strand+
Gene length (bp)1079
Transcript length (bp)885
Coding sequence length (bp)885
Protein length (aa) 295

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04733 Coatomer_E Coatomer epsilon subunit 3.4E-60 9 288
PF14559 TPR_19 Tetratricopeptide repeat 1.7E-05 183 236

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q28104|COPE_BOVIN Coatomer subunit epsilon OS=Bos taurus GN=COPE PE=1 SV=3 9 289 8.0E-32
sp|Q5RFR8|COPE_PONAB Coatomer subunit epsilon OS=Pongo abelii GN=COPE PE=2 SV=1 9 289 8.0E-32
sp|O14579|COPE_HUMAN Coatomer subunit epsilon OS=Homo sapiens GN=COPE PE=1 SV=3 9 289 8.0E-32
sp|O89079|COPE_MOUSE Coatomer subunit epsilon OS=Mus musculus GN=Cope PE=1 SV=3 9 289 1.0E-31
sp|Q60445|COPE_CRIGR Coatomer subunit epsilon OS=Cricetulus griseus GN=COPE PE=2 SV=2 9 289 3.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q28104|COPE_BOVIN Coatomer subunit epsilon OS=Bos taurus GN=COPE PE=1 SV=3 9 289 8.0E-32
sp|Q5RFR8|COPE_PONAB Coatomer subunit epsilon OS=Pongo abelii GN=COPE PE=2 SV=1 9 289 8.0E-32
sp|O14579|COPE_HUMAN Coatomer subunit epsilon OS=Homo sapiens GN=COPE PE=1 SV=3 9 289 8.0E-32
sp|O89079|COPE_MOUSE Coatomer subunit epsilon OS=Mus musculus GN=Cope PE=1 SV=3 9 289 1.0E-31
sp|Q60445|COPE_CRIGR Coatomer subunit epsilon OS=Cricetulus griseus GN=COPE PE=2 SV=2 9 289 3.0E-31
sp|Q5ZIK9|COPE_CHICK Coatomer subunit epsilon OS=Gallus gallus GN=COPE PE=2 SV=1 9 289 4.0E-31
sp|Q9SA78|COPE1_ARATH Coatomer subunit epsilon-1 OS=Arabidopsis thaliana GN=At1g30630 PE=2 SV=1 1 271 4.0E-30
sp|O74767|COPE_SCHPO Probable coatomer subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec28 PE=1 SV=1 5 288 1.0E-28
sp|O64748|COPE2_ARATH Coatomer subunit epsilon-2 OS=Arabidopsis thaliana GN=At2g34840 PE=2 SV=1 9 284 2.0E-28
sp|Q9MAX6|COPE1_ORYSJ Coatomer subunit epsilon-1 OS=Oryza sativa subsp. japonica GN=COPE1 PE=2 SV=1 10 271 3.0E-27
sp|P0C541|COPE2_ORYSJ Coatomer subunit epsilon-2 OS=Oryza sativa subsp. japonica GN=Os04g0644700 PE=3 SV=1 9 289 6.0E-27
sp|A2XY73|COPE2_ORYSI Coatomer subunit epsilon-2 OS=Oryza sativa subsp. indica GN=H0413E07.10 PE=3 SV=2 9 289 2.0E-26
sp|Q55FU2|COPE_DICDI Coatomer subunit epsilon OS=Dictyostelium discoideum GN=cope PE=3 SV=1 14 289 4.0E-17
sp|O62246|COPE_CAEEL Coatomer subunit epsilon OS=Caenorhabditis elegans GN=cope-1 PE=3 SV=1 9 286 2.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7953
MDPFSAEGELINIQNHFHQGQYQEVVDFDTSSFSPENSLPARVLQLRARIALGQANDVLAQVKGKSEPEMEAIGA
LAELSLGKKASAVQTIEKLASSAADNVTVQIVGGTVLQAAGKSEEALALLSQHQASLEAVSLIVQIHLEQNRTDL
AVKEVTAARRWAQDSLLVNLAEAWVGLREGGEKYQQAFYVFEELAQAPSTSSIRSLVSQAVCEIHLGRLEEAQAA
LEQALKKDPEYVEAIANMLVLKAISGSDATESMESLKKLGPDHRLLVDLEEKSALFDKAASKYSAKVPS*
Coding >Hirsu2|7953
ATGGATCCGTTCTCTGCAGAAGGCGAATTGATCAACATCCAAAACCACTTCCACCAGGGCCAGTACCAGGAAGTC
GTCGATTTCGACACCTCGTCCTTCTCGCCCGAAAACTCCTTGCCGGCTCGTGTGCTGCAGCTGCGGGCACGCATC
GCCCTCGGCCAGGCCAATGACGTCCTCGCGCAAGTCAAGGGCAAGTCGGAGCCTGAAATGGAGGCGATTGGGGCC
CTCGCCGAACTGTCCCTGGGGAAGAAGGCGTCCGCTGTGCAGACGATCGAAAAGCTAGCCTCGTCGGCCGCCGAC
AATGTTACCGTCCAGATCGTGGGCGGGACGGTGCTGCAGGCCGCGGGCAAGTCCGAGGAGGCACTGGCCCTGCTG
TCGCAACACCAGGCTAGCCTCGAGGCCGTCTCCTTGATCGTGCAGATCCATCTCGAACAAAACCGAACCGACCTC
GCCGTCAAGGAAGTCACCGCCGCGCGAAGATGGGCCCAGGATAGTCTCTTGGTCAACTTGGCCGAGGCGTGGGTC
GGACTGAGAGAGGGCGGAGAGAAGTATCAACAAGCGTTCTACGTGTTCGAGGAGCTCGCGCAGGCTCCGTCAACA
TCGTCGATACGGAGCCTCGTCTCCCAGGCCGTCTGCGAGATCCACCTGGGCCGCCTGGAGGAAGCCCAAGCGGCG
CTAGAGCAGGCGCTGAAGAAGGACCCGGAATACGTAGAGGCCATTGCCAACATGCTGGTTCTCAAGGCCATTTCT
GGAAGTGACGCTACGGAGTCTATGGAATCACTCAAAAAGCTCGGCCCGGATCACCGGCTACTCGTCGACCTGGAG
GAGAAGAGCGCCCTGTTTGACAAGGCGGCGTCAAAGTACAGCGCCAAGGTCCCTTCATGA
Transcript >Hirsu2|7953
ATGGATCCGTTCTCTGCAGAAGGCGAATTGATCAACATCCAAAACCACTTCCACCAGGGCCAGTACCAGGAAGTC
GTCGATTTCGACACCTCGTCCTTCTCGCCCGAAAACTCCTTGCCGGCTCGTGTGCTGCAGCTGCGGGCACGCATC
GCCCTCGGCCAGGCCAATGACGTCCTCGCGCAAGTCAAGGGCAAGTCGGAGCCTGAAATGGAGGCGATTGGGGCC
CTCGCCGAACTGTCCCTGGGGAAGAAGGCGTCCGCTGTGCAGACGATCGAAAAGCTAGCCTCGTCGGCCGCCGAC
AATGTTACCGTCCAGATCGTGGGCGGGACGGTGCTGCAGGCCGCGGGCAAGTCCGAGGAGGCACTGGCCCTGCTG
TCGCAACACCAGGCTAGCCTCGAGGCCGTCTCCTTGATCGTGCAGATCCATCTCGAACAAAACCGAACCGACCTC
GCCGTCAAGGAAGTCACCGCCGCGCGAAGATGGGCCCAGGATAGTCTCTTGGTCAACTTGGCCGAGGCGTGGGTC
GGACTGAGAGAGGGCGGAGAGAAGTATCAACAAGCGTTCTACGTGTTCGAGGAGCTCGCGCAGGCTCCGTCAACA
TCGTCGATACGGAGCCTCGTCTCCCAGGCCGTCTGCGAGATCCACCTGGGCCGCCTGGAGGAAGCCCAAGCGGCG
CTAGAGCAGGCGCTGAAGAAGGACCCGGAATACGTAGAGGCCATTGCCAACATGCTGGTTCTCAAGGCCATTTCT
GGAAGTGACGCTACGGAGTCTATGGAATCACTCAAAAAGCTCGGCCCGGATCACCGGCTACTCGTCGACCTGGAG
GAGAAGAGCGCCCTGTTTGACAAGGCGGCGTCAAAGTACAGCGCCAAGGTCCCTTCATGA
Gene >Hirsu2|7953
ATGGATCCGTTCTCTGCAGAAGGCGAATTGATCAACATCCAAAACCACTTCCACCAGGGCCAGTACCAGGAAGTC
GTCGATTTCGACACCTCGTCCTTCTCGCCCGAAAACTCCTTGCCGGCTCGTGTGCTGCAGCTGCGGGCACGCATC
GCCCTCGGCCAGGCCAATGACGTCCTCGCGCAAGTCAAGGGCAAGTCGGAGCCTGAAATGGAGGCGATTGGGGCC
CTCGCCGAACTGTCCCTGGGGAAGAAGGCGTCCGCTGTGCAGACGATCGAAAAGCTAGCCTCGTCGGCCGCCGAC
AATGTTACCGTCCAGATCGTGGGCGGGACGGTGCTGCAGGCCGCGGGCAAGTCCGAGGAGGCACTGGCCCTGCTG
TCGCAACACCAGGCTAGCCGTGAGTACCAGGGGCCGTCCGGGATCGTGCTAGGCTGCGGACTGGGGCTGACACTT
GAACGCAGTCGAGGCCGTCTCCTTGATCGTGCAGATCCATCTCGAACAAAACCGAACCGACCTCGCCGTCAAGGA
AGTCACCGCCGCGCGAAGATGGGCCCAGGATAGTCTCTTGGTCAACTTGGCCGAGGCGTGGGTCGGACTGAGAGA
GGTGCGGCGCAACTCGACGCTTATTTCGCGACGCACGCTACCCCAAGGCGAGACGGCAATGCTGACTTCGTGCAG
GGCGGAGAGAAGTATCAACAAGCGTTCTACGTGTTCGAGGAGCTCGCGCAGGCTCCGTCAACATCGTCGATACGG
AGCCTCGTCTCCCAGGCCGTCTGCGAGATCCACCTGGGCCGCCTGGAGGAAGCCCAAGCGGCGCTAGAGCAGGCG
CTGAAGAAGGACCCGGAATACGTAGAGGCCATTGCCAACATGCTGGTTCTCAAGGCCATTTCTGGAAGTGACGCT
ACGGAGTCTATGGAGTGAGCCCCTCTCTTTGTCCCTGGATTCGGCTTCATTCCATGTTGACGCGCCACAGATCAC
TCAAAAAGCTCGGCCCGGATCACCGGCTACTCGTCGACCTGGAGGAGAAGAGCGCCCTGTTTGACAAGGCGGCGT
CAAAGTACAGCGCCAAGGTCCCTTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail