Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|795
Gene name
LocationContig_1165:2613..3146
Strand+
Gene length (bp)533
Transcript length (bp)468
Coding sequence length (bp)468
Protein length (aa) 156

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07039 DUF1325 SGF29 tudor-like domain 5.3E-37 25 153

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USW9|SGF29_SCHPO SAGA-associated factor 29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgf29 PE=1 SV=2 13 153 7.0E-21
sp|P25554|SGF29_YEAST SAGA-associated factor 29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGF29 PE=1 SV=2 26 151 3.0E-15

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5278 0.4931 0.366 0.1626 0.1961 0.036 0.0438 0.2173 0.0965 0.0108

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5646
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1254
Ophiocordyceps australis map64 (Brazil) OphauB2|7565
Ophiocordyceps camponoti-rufipedis Ophun1|6961
Ophiocordyceps kimflemingae Ophio5|4266
Ophiocordyceps subramaniannii Hirsu2|795 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|795
MVYVATAQAGGSGGSNNRSRVVFSKGDAVAFKPKAASGEASSDWILGEVAQVLGEGKSRRYKVLDIEPDDQSKQK
EYRSSASSMIAITPESQAGTLRAWEAGKVVLALYPNTTTFYKAEVHSMHADGRVNLKFEGENDSTTLQQVERRFV
IEYRA*
Coding >Hirsu2|795
ATGGTTTACGTGGCGACGGCGCAGGCCGGCGGCAGCGGCGGCAGCAACAACCGCTCTCGCGTCGTCTTCTCCAAG
GGCGATGCCGTCGCTTTCAAGCCGAAGGCGGCGAGCGGCGAGGCGTCGTCGGACTGGATCCTGGGCGAGGTGGCG
CAGGTGCTGGGCGAGGGTAAGAGCCGGCGGTACAAGGTGCTGGACATCGAGCCAGACGACCAGAGCAAGCAGAAG
GAGTACCGGTCGAGCGCGAGCAGCATGATCGCCATCACGCCCGAGAGCCAGGCGGGCACGCTGCGGGCGTGGGAG
GCCGGCAAGGTGGTGCTGGCGCTGTACCCCAACACGACAACCTTCTACAAGGCCGAGGTGCACAGCATGCACGCC
GACGGCCGCGTCAACCTCAAGTTCGAGGGCGAGAACGACTCGACGACGCTGCAGCAGGTGGAGAGGCGGTTCGTG
ATCGAGTACCGCGCCTGA
Transcript >Hirsu2|795
ATGGTTTACGTGGCGACGGCGCAGGCCGGCGGCAGCGGCGGCAGCAACAACCGCTCTCGCGTCGTCTTCTCCAAG
GGCGATGCCGTCGCTTTCAAGCCGAAGGCGGCGAGCGGCGAGGCGTCGTCGGACTGGATCCTGGGCGAGGTGGCG
CAGGTGCTGGGCGAGGGTAAGAGCCGGCGGTACAAGGTGCTGGACATCGAGCCAGACGACCAGAGCAAGCAGAAG
GAGTACCGGTCGAGCGCGAGCAGCATGATCGCCATCACGCCCGAGAGCCAGGCGGGCACGCTGCGGGCGTGGGAG
GCCGGCAAGGTGGTGCTGGCGCTGTACCCCAACACGACAACCTTCTACAAGGCCGAGGTGCACAGCATGCACGCC
GACGGCCGCGTCAACCTCAAGTTCGAGGGCGAGAACGACTCGACGACGCTGCAGCAGGTGGAGAGGCGGTTCGTG
ATCGAGTACCGCGCCTGA
Gene >Hirsu2|795
ATGGTTTACGTGGGTGCGTGAACAAGCTAGACAACGACGGCATTGGCAACGGGCAGGCCCTGGCTCTCGACGCGG
TAGCGACGGCGCAGGCCGGCGGCAGCGGCGGCAGCAACAACCGCTCTCGCGTCGTCTTCTCCAAGGGCGATGCCG
TCGCTTTCAAGCCGAAGGCGGCGAGCGGCGAGGCGTCGTCGGACTGGATCCTGGGCGAGGTGGCGCAGGTGCTGG
GCGAGGGTAAGAGCCGGCGGTACAAGGTGCTGGACATCGAGCCAGACGACCAGAGCAAGCAGAAGGAGTACCGGT
CGAGCGCGAGCAGCATGATCGCCATCACGCCCGAGAGCCAGGCGGGCACGCTGCGGGCGTGGGAGGCCGGCAAGG
TGGTGCTGGCGCTGTACCCCAACACGACAACCTTCTACAAGGCCGAGGTGCACAGCATGCACGCCGACGGCCGCG
TCAACCTCAAGTTCGAGGGCGAGAACGACTCGACGACGCTGCAGCAGGTGGAGAGGCGGTTCGTGATCGAGTACC
GCGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail