Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7941
Gene name
LocationContig_490:15837..17609
Strand+
Gene length (bp)1772
Transcript length (bp)1515
Coding sequence length (bp)1515
Protein length (aa) 505

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00996 GDI GDP dissociation inhibitor 1.0E-21 6 310

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32864|RAEP_YEAST Rab proteins geranylgeranyltransferase component A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS6 PE=1 SV=2 10 419 4.0E-54
sp|O93831|RAEP_CANAX Rab proteins geranylgeranyltransferase component A OS=Candida albicans GN=MRS6 PE=3 SV=1 10 419 5.0E-37
sp|O60112|YG63_SCHPO Uncharacterized Rab geranylgeranyltransferase C15C4.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.03 PE=3 SV=1 9 414 7.0E-29
sp|Q9V8W3|RABEP_DROME Rab proteins geranylgeranyltransferase component A OS=Drosophila melanogaster GN=Rep PE=2 SV=1 8 280 1.0E-20
sp|Q9QXG2|RAE1_MOUSE Rab proteins geranylgeranyltransferase component A 1 OS=Mus musculus GN=Chm PE=1 SV=1 87 437 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32864|RAEP_YEAST Rab proteins geranylgeranyltransferase component A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS6 PE=1 SV=2 10 419 4.0E-54
sp|O93831|RAEP_CANAX Rab proteins geranylgeranyltransferase component A OS=Candida albicans GN=MRS6 PE=3 SV=1 10 419 5.0E-37
sp|O60112|YG63_SCHPO Uncharacterized Rab geranylgeranyltransferase C15C4.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.03 PE=3 SV=1 9 414 7.0E-29
sp|Q9V8W3|RABEP_DROME Rab proteins geranylgeranyltransferase component A OS=Drosophila melanogaster GN=Rep PE=2 SV=1 8 280 1.0E-20
sp|Q9QXG2|RAE1_MOUSE Rab proteins geranylgeranyltransferase component A 1 OS=Mus musculus GN=Chm PE=1 SV=1 87 437 1.0E-18
sp|P37727|RAE1_RAT Rab proteins geranylgeranyltransferase component A 1 OS=Rattus norvegicus GN=Chm PE=1 SV=1 41 437 1.0E-17
sp|Q9LXC0|GDI_ARATH Guanosine nucleotide diphosphate dissociation inhibitor At5g09550 OS=Arabidopsis thaliana GN=At5g09550 PE=3 SV=1 6 274 2.0E-15
sp|P24386|RAE1_HUMAN Rab proteins geranylgeranyltransferase component A 1 OS=Homo sapiens GN=CHM PE=1 SV=3 87 437 4.0E-15
sp|P26374|RAE2_HUMAN Rab proteins geranylgeranyltransferase component A 2 OS=Homo sapiens GN=CHML PE=1 SV=2 87 277 2.0E-14
sp|Q96254|GDI1_ARATH Guanosine nucleotide diphosphate dissociation inhibitor 1 OS=Arabidopsis thaliana GN=GDI1 PE=1 SV=1 6 401 3.0E-14
sp|Q10305|GDI1_SCHPO Probable secretory pathway GDP dissociation inhibitor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gdi1 PE=3 SV=1 6 396 4.0E-14
sp|Q9QZD5|RAE2_MOUSE Rab proteins geranylgeranyltransferase component A 2 OS=Mus musculus GN=Chml PE=2 SV=2 86 439 5.0E-14
sp|O24653|GDI2_ARATH Guanosine nucleotide diphosphate dissociation inhibitor 2 OS=Arabidopsis thaliana GN=GDI2 PE=2 SV=1 6 291 1.0E-13
sp|O97555|GDIA_CANLF Rab GDP dissociation inhibitor alpha OS=Canis lupus familiaris GN=GDI1 PE=2 SV=1 6 280 4.0E-13
sp|Q7YQM0|GDIA_PONPY Rab GDP dissociation inhibitor alpha OS=Pongo pygmaeus GN=GDI1 PE=2 SV=1 6 280 6.0E-13
sp|P50398|GDIA_RAT Rab GDP dissociation inhibitor alpha OS=Rattus norvegicus GN=Gdi1 PE=1 SV=1 6 280 7.0E-13
sp|Q8HXX7|GDIA_MACFA Rab GDP dissociation inhibitor alpha OS=Macaca fascicularis GN=GDI1 PE=2 SV=1 6 280 7.0E-13
sp|P50396|GDIA_MOUSE Rab GDP dissociation inhibitor alpha OS=Mus musculus GN=Gdi1 PE=1 SV=3 6 280 7.0E-13
sp|P21856|GDIA_BOVIN Rab GDP dissociation inhibitor alpha OS=Bos taurus GN=GDI1 PE=1 SV=1 6 280 1.0E-12
sp|P60028|GDIA_PANTR Rab GDP dissociation inhibitor alpha OS=Pan troglodytes GN=GDI1 PE=2 SV=1 6 280 1.0E-12
sp|P31150|GDIA_HUMAN Rab GDP dissociation inhibitor alpha OS=Homo sapiens GN=GDI1 PE=1 SV=2 6 280 1.0E-12
sp|P39958|GDI1_YEAST Rab GDP-dissociation inhibitor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDI1 PE=1 SV=1 6 298 7.0E-12
sp|Q6Q7J2|GDIB_PIG Rab GDP dissociation inhibitor beta OS=Sus scrofa GN=GDI2 PE=2 SV=1 6 280 3.0E-11
sp|Q61598|GDIB_MOUSE Rab GDP dissociation inhibitor beta OS=Mus musculus GN=Gdi2 PE=1 SV=1 6 280 4.0E-11
sp|O97556|GDIB_CANLF Rab GDP dissociation inhibitor beta OS=Canis lupus familiaris GN=GDI2 PE=2 SV=1 6 280 4.0E-11
sp|P50399|GDIB_RAT Rab GDP dissociation inhibitor beta OS=Rattus norvegicus GN=Gdi2 PE=1 SV=2 6 280 4.0E-11
sp|P50397|GDIB_BOVIN Rab GDP dissociation inhibitor beta OS=Bos taurus GN=GDI2 PE=2 SV=3 6 280 9.0E-11
sp|P50395|GDIB_HUMAN Rab GDP dissociation inhibitor beta OS=Homo sapiens GN=GDI2 PE=1 SV=2 6 280 2.0E-10
sp|Q5RCE1|GDIB_PONAB Rab GDP dissociation inhibitor beta OS=Pongo abelii GN=GDI2 PE=2 SV=1 6 280 2.0E-10
sp|Q9QZD5|RAE2_MOUSE Rab proteins geranylgeranyltransferase component A 2 OS=Mus musculus GN=Chml PE=2 SV=2 7 65 5.0E-07
sp|P26374|RAE2_HUMAN Rab proteins geranylgeranyltransferase component A 2 OS=Homo sapiens GN=CHML PE=1 SV=2 7 65 6.0E-07
sp|P24386|RAE1_HUMAN Rab proteins geranylgeranyltransferase component A 1 OS=Homo sapiens GN=CHM PE=1 SV=3 7 87 1.0E-06
sp|P37727|RAE1_RAT Rab proteins geranylgeranyltransferase component A 1 OS=Rattus norvegicus GN=Chm PE=1 SV=1 9 63 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0007264 small GTPase mediated signal transduction Yes
GO:0005092 GDP-dissociation inhibitor activity Yes
GO:0007165 signal transduction No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0008150 biological_process No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0065007 biological regulation No
GO:0035556 intracellular signal transduction No
GO:0003674 molecular_function No
GO:0030234 enzyme regulator activity No
GO:0030695 GTPase regulator activity No
GO:0050794 regulation of cellular process No
GO:0098772 molecular function regulator No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7941
MESLSDTRWDVVISGTGLQQSLLALALSRSDKAILHLDPNGYYGGSEAALSLQEVDEWVDKHRATESGSPFAAAH
LDKAGDGLSFSRAYSLALAPQLIHTRSLLLSQLVSSKAFRQVEFLAVGSFYIFHPASGSSGTPSLGRVPSTREDV
FAATAIPPRSKRALMKFLKFVLGYDAEPQEEVWKPRADEELTAFLESEFKLDRELQLYVVALTLSLDGRISVGAG
LAAIHRHLTSMGLFGPGFAAVYPKWGGLSEVAQVGCRAAAVGGAVYMLGTGVSDVTRVASADDGGESGLQVTLSN
DVVVKTQTLVQGSSTPSAGAAAIRRLTAVIDSGLSLVFGAVVEDAPTPCVAVVAFPRGSITASDGTTSDFPIYAL
VHSSDTGECPAGQCTVYLSTMSGPQSRQMLEAALSSLLTALAPEGERPTCLYRLGYEQRGGTGAFMADGGIGTFA
LPSLELALPDSAVAPVREAWAMVTGGDGADGEGYMRFEDREGVADDEDALHGAE*
Coding >Hirsu2|7941
ATGGAAAGCCTTTCAGACACTCGGTGGGATGTCGTGATCAGCGGCACCGGCCTCCAGCAGTCCCTCCTGGCCCTG
GCGTTGTCGCGGTCAGACAAGGCCATACTGCACCTTGACCCCAATGGCTACTATGGCGGGTCGGAGGCAGCCCTC
AGCCTGCAGGAGGTGGACGAGTGGGTGGACAAGCACCGGGCCACAGAGTCCGGCAGTCCCTTCGCGGCAGCGCAT
CTGGACAAGGCCGGCGACGGACTGTCGTTCTCGCGAGCCTACAGCCTGGCCCTGGCGCCACAGCTGATCCATACG
CGATCCCTGCTCCTGTCGCAGCTGGTCTCGTCAAAGGCCTTCCGTCAGGTCGAGTTTCTCGCCGTCGGATCCTTC
TACATCTTCCACCCGGCGTCTGGCTCCTCTGGGACGCCGAGCCTCGGCCGGGTGCCCTCGACGCGAGAGGACGTC
TTCGCCGCCACGGCGATACCACCTCGGTCCAAGCGTGCCTTGATGAAGTTTCTCAAGTTCGTGCTCGGATACGAT
GCGGAGCCGCAAGAAGAGGTGTGGAAGCCGCGGGCGGACGAGGAGCTGACGGCCTTTCTCGAGTCGGAGTTCAAG
CTGGATCGCGAGCTGCAGCTCTACGTCGTCGCCCTGACACTCAGTCTGGATGGCAGAATATCGGTCGGAGCCGGA
CTCGCCGCTATACACCGCCACCTGACCTCTATGGGACTTTTCGGCCCGGGCTTCGCTGCCGTCTACCCCAAGTGG
GGTGGTCTATCCGAGGTCGCCCAAGTGGGCTGCCGTGCCGCCGCCGTCGGTGGCGCCGTCTACATGCTGGGGACG
GGCGTCTCAGACGTTACAAGAGTAGCCTCTGCGGATGACGGCGGCGAGTCCGGGCTTCAAGTCACACTTTCCAAC
GACGTCGTCGTCAAGACACAAACCTTGGTCCAAGGCTCAAGCACCCCTTCCGCCGGAGCTGCAGCCATTCGCCGG
CTCACCGCCGTCATCGACTCGGGCTTATCCCTGGTCTTCGGGGCTGTCGTCGAGGACGCTCCCACGCCGTGTGTG
GCGGTGGTAGCGTTCCCACGAGGGTCGATCACGGCCTCTGACGGCACCACCTCCGACTTCCCGATATACGCACTG
GTGCACTCGAGCGACACGGGCGAATGCCCCGCAGGTCAATGCACTGTATACCTGAGTACGATGTCCGGGCCGCAG
TCGAGGCAGATGCTGGAAGCGGCACTGTCGTCGCTCCTCACCGCCCTGGCGCCGGAAGGCGAGAGGCCCACGTGC
CTGTACAGGCTGGGCTACGAGCAGAGGGGCGGCACGGGCGCGTTCATGGCGGACGGCGGCATCGGCACCTTCGCC
CTGCCGTCGCTGGAGCTGGCGCTGCCCGACTCGGCCGTCGCGCCCGTCCGCGAGGCCTGGGCCATGGTGACGGGC
GGCGACGGGGCCGACGGCGAGGGTTACATGAGGTTCGAGGACAGGGAGGGAGTGGCAGACGACGAGGACGCCTTG
CACGGCGCGGAGTGA
Transcript >Hirsu2|7941
ATGGAAAGCCTTTCAGACACTCGGTGGGATGTCGTGATCAGCGGCACCGGCCTCCAGCAGTCCCTCCTGGCCCTG
GCGTTGTCGCGGTCAGACAAGGCCATACTGCACCTTGACCCCAATGGCTACTATGGCGGGTCGGAGGCAGCCCTC
AGCCTGCAGGAGGTGGACGAGTGGGTGGACAAGCACCGGGCCACAGAGTCCGGCAGTCCCTTCGCGGCAGCGCAT
CTGGACAAGGCCGGCGACGGACTGTCGTTCTCGCGAGCCTACAGCCTGGCCCTGGCGCCACAGCTGATCCATACG
CGATCCCTGCTCCTGTCGCAGCTGGTCTCGTCAAAGGCCTTCCGTCAGGTCGAGTTTCTCGCCGTCGGATCCTTC
TACATCTTCCACCCGGCGTCTGGCTCCTCTGGGACGCCGAGCCTCGGCCGGGTGCCCTCGACGCGAGAGGACGTC
TTCGCCGCCACGGCGATACCACCTCGGTCCAAGCGTGCCTTGATGAAGTTTCTCAAGTTCGTGCTCGGATACGAT
GCGGAGCCGCAAGAAGAGGTGTGGAAGCCGCGGGCGGACGAGGAGCTGACGGCCTTTCTCGAGTCGGAGTTCAAG
CTGGATCGCGAGCTGCAGCTCTACGTCGTCGCCCTGACACTCAGTCTGGATGGCAGAATATCGGTCGGAGCCGGA
CTCGCCGCTATACACCGCCACCTGACCTCTATGGGACTTTTCGGCCCGGGCTTCGCTGCCGTCTACCCCAAGTGG
GGTGGTCTATCCGAGGTCGCCCAAGTGGGCTGCCGTGCCGCCGCCGTCGGTGGCGCCGTCTACATGCTGGGGACG
GGCGTCTCAGACGTTACAAGAGTAGCCTCTGCGGATGACGGCGGCGAGTCCGGGCTTCAAGTCACACTTTCCAAC
GACGTCGTCGTCAAGACACAAACCTTGGTCCAAGGCTCAAGCACCCCTTCCGCCGGAGCTGCAGCCATTCGCCGG
CTCACCGCCGTCATCGACTCGGGCTTATCCCTGGTCTTCGGGGCTGTCGTCGAGGACGCTCCCACGCCGTGTGTG
GCGGTGGTAGCGTTCCCACGAGGGTCGATCACGGCCTCTGACGGCACCACCTCCGACTTCCCGATATACGCACTG
GTGCACTCGAGCGACACGGGCGAATGCCCCGCAGGTCAATGCACTGTATACCTGAGTACGATGTCCGGGCCGCAG
TCGAGGCAGATGCTGGAAGCGGCACTGTCGTCGCTCCTCACCGCCCTGGCGCCGGAAGGCGAGAGGCCCACGTGC
CTGTACAGGCTGGGCTACGAGCAGAGGGGCGGCACGGGCGCGTTCATGGCGGACGGCGGCATCGGCACCTTCGCC
CTGCCGTCGCTGGAGCTGGCGCTGCCCGACTCGGCCGTCGCGCCCGTCCGCGAGGCCTGGGCCATGGTGACGGGC
GGCGACGGGGCCGACGGCGAGGGTTACATGAGGTTCGAGGACAGGGAGGGAGTGGCAGACGACGAGGACGCCTTG
CACGGCGCGGAGTGA
Gene >Hirsu2|7941
ATGGAAAGCCTTTCAGACACTCGGTGGGATGTCGTGATCAGCGGCACCGGCCTCCAGCAGTCCCTCCTGGCCCTG
TAAGCACAGGCTCTGTACGGCGCGGCTATCAAACTGACTGACCAGCCGGTCCCGCCGGGCGCAGGGCGTTGTCGC
GGTCAGACAAGGCCATACTGCACCTTGACCCCAATGGCTACTATGGCGGGTCGGAGGCAGCCCTCAGCCTGCAGG
AGGTGGACGAGTGGGTGGACAAGCACCGGGCCACAGAGTCCGGCAGTCCCTTCGCGGCAGCGCATCTGGACAAGG
CCGGCGACGGACTGTCGTTCTCGCGAGCCTACAGCCTGGCCCTGGCGCCACAGCTGATCCATACGCGATCCCTGC
TCCTGTCGCAGCTGGTCTCGTCAAAGGCCTTCCGTCAGGTCGAGTTTCTCGCCGTCGGATCCTTCTACATCTTCC
ACCCGGCGTCTGGCTCCTCTGGGACGCCGAGCCTCGGCCGGGTGCCCTCGACGCGAGAGGACGTCTTCGCCGCCA
CGGCGATACCACCTCGGTCCAAGCGTGCCTTGATGAAGTTTCTCAAGTTCGTGCTCGGATACGATGCGGAGCCGC
AAGAAGAGGTGTGGAAGCCGCGGGCGGACGAGGAGCTGACGGCCTTTCTCGAGTCGGAGTTCAAGCTGGATCGCG
AGCTGCAGCTCTACGTCGTCGCCCTGACACTCAGTCTGGATGGCAGAATATCGGTCGGAGCCGGACTCGCCGCTA
TACACCGCCACCTGACCTCTATGGGACTTTTCGGCCCGGGCTTCGCTGCCGTCTACCCCAAGTGGGGTGGTCTAT
CCGAGGTCGCCCAAGTGGGCTGCCGTGCCGCCGCCGTCGGTGGCGCCGTCTACATGCTGGGGACGGGCGTCTCAG
ACGTTACAAGAGTAGCCTCTGCGGATGACGGCGGCGAGTCCGGGCTTCAAGTCACACTTTCCAACGACGTCGTCG
TCAAGACACAAACCTTGGTCCAAGGCTCAAGCACCCCTTCCGCCGGAGCTGCAGCCATTCGCCGGCTCACCGCCG
TCATCGACTCGGGCTTATCCCTGGTCTTCGGGGCTGTCGTCGAGGACGCTCCCACGCCGTGTGTGGCGGTGGTAG
CGTTCCCACGAGGGTCGATCACGGCCTCTGACGGCACCACCTCCGACTTCCCGATATACGCACTGGTGCACTCGA
GCGACACGGGCGAATGCCCCGCAGGTCAATGTGAGCCATCTTGATTTCTTGTCTCGTCCCCCCCGTGTGCTATGA
TGATTTCTCAACAAACGAATACTTATCTACATTGTCTGATTTTCAATGACGACATGATACTCTGACAACCTGATT
GCGCACCCATCTCACCTAGCCCCTTGTCGCGGAAGATGCTTTGGGACCACCGTCGCTGACCCGTCTCTGCAGGCA
CTGTATACCTGAGTACGATGTCCGGGCCGCAGTCGAGGCAGATGCTGGAAGCGGCACTGTCGTCGCTCCTCACCG
CCCTGGCGCCGGAAGGCGAGAGGCCCACGTGCCTGTACAGGCTGGGCTACGAGCAGAGGGGCGGCACGGGCGCGT
TCATGGCGGACGGCGGCATCGGCACCTTCGCCCTGCCGTCGCTGGAGCTGGCGCTGCCCGACTCGGCCGTCGCGC
CCGTCCGCGAGGCCTGGGCCATGGTGACGGGCGGCGACGGGGCCGACGGCGAGGGTTACATGAGGTTCGAGGACA
GGGAGGGAGTGGCAGACGACGAGGACGCCTTGCACGGCGCGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail