Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7938
Gene name
LocationContig_490:7703..10244
Strand-
Gene length (bp)2541
Transcript length (bp)2541
Coding sequence length (bp)2541
Protein length (aa) 847

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 2.3E-18 197 319
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 2.8E-12 475 821
PF08022 FAD_binding_8 FAD-binding domain 1.1E-11 367 466

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12333|FRE7_YEAST Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE7 PE=1 SV=2 34 530 9.0E-52
sp|A6ZN61|FRE7_YEAS7 Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain YJM789) GN=FRE7 PE=3 SV=1 34 536 3.0E-51
sp|P53746|FRE4_YEAST Ferric reductase transmembrane component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE4 PE=2 SV=1 192 530 7.0E-25
sp|Q08908|FRE5_YEAST Ferric reductase transmembrane component 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE5 PE=2 SV=1 38 613 3.0E-24
sp|P78588|FREL_CANAX Probable ferric reductase transmembrane component OS=Candida albicans GN=CFL1 PE=3 SV=1 192 542 7.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12333|FRE7_YEAST Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE7 PE=1 SV=2 34 530 9.0E-52
sp|A6ZN61|FRE7_YEAS7 Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain YJM789) GN=FRE7 PE=3 SV=1 34 536 3.0E-51
sp|P53746|FRE4_YEAST Ferric reductase transmembrane component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE4 PE=2 SV=1 192 530 7.0E-25
sp|Q08908|FRE5_YEAST Ferric reductase transmembrane component 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE5 PE=2 SV=1 38 613 3.0E-24
sp|P78588|FREL_CANAX Probable ferric reductase transmembrane component OS=Candida albicans GN=CFL1 PE=3 SV=1 192 542 7.0E-24
sp|Q5A446|FRE1_CANAL Ferric/cupric reductase transmembrane component 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFL1 PE=2 SV=1 192 542 5.0E-23
sp|Q08905|FRE3_YEAST Ferric reductase transmembrane component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE3 PE=1 SV=1 192 535 2.0E-21
sp|P36033|FRE2_YEAST Ferric/cupric reductase transmembrane component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE2 PE=1 SV=1 192 536 3.0E-21
sp|O94727|FRP2_SCHPO Ferric/cupric reductase transmembrane component 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp2 PE=3 SV=1 192 523 2.0E-16
sp|Q3KTM0|FRO7_ARATH Ferric reduction oxidase 7, chloroplastic OS=Arabidopsis thaliana GN=FRO7 PE=2 SV=1 193 547 2.0E-15
sp|Q8HZK2|DUOX2_PIG Dual oxidase 2 OS=Sus scrofa GN=DUOX2 PE=1 SV=2 149 580 2.0E-15
sp|Q8RWS6|FRO6_ARATH Ferric reduction oxidase 6 OS=Arabidopsis thaliana GN=FRO6 PE=2 SV=1 193 547 1.0E-14
sp|P32791|FRE1_YEAST Ferric/cupric reductase transmembrane component 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE1 PE=1 SV=1 195 542 3.0E-14
sp|Q9FLW2|FRO5_ARATH Ferric reduction oxidase 5 OS=Arabidopsis thaliana GN=FRO5 PE=2 SV=1 213 523 4.0E-14
sp|Q8W110|FRO4_ARATH Ferric reduction oxidase 4 OS=Arabidopsis thaliana GN=FRO4 PE=2 SV=1 140 523 1.0E-13
sp|Q8VY13|FRO8_ARATH Ferric reduction oxidase 8, mitochondrial OS=Arabidopsis thaliana GN=FRO8 PE=2 SV=1 192 524 9.0E-13
sp|Q9XYS3|NOXA_DICDI Superoxide-generating NADPH oxidase heavy chain subunit A OS=Dictyostelium discoideum GN=noxA PE=2 SV=1 207 526 2.0E-12
sp|O81210|RBOHC_ARATH Respiratory burst oxidase homolog protein C OS=Arabidopsis thaliana GN=RBOHC PE=2 SV=2 239 574 2.0E-12
sp|Q9FIJ0|RBOHD_ARATH Respiratory burst oxidase homolog protein D OS=Arabidopsis thaliana GN=RBOHD PE=1 SV=1 278 527 6.0E-12
sp|O81209|RBOHA_ARATH Respiratory burst oxidase homolog protein A OS=Arabidopsis thaliana GN=RBOHA PE=2 SV=2 304 577 8.0E-12
sp|Q12473|FRE6_YEAST Ferric reductase transmembrane component 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE6 PE=1 SV=1 192 476 3.0E-11
sp|Q948T9|RBOHB_SOLTU Respiratory burst oxidase homolog protein B OS=Solanum tuberosum GN=RBOHB PE=1 SV=1 278 527 4.0E-11
sp|Q86GL4|NOXB_DICDI Superoxide-generating NADPH oxidase heavy chain subunit B OS=Dictyostelium discoideum GN=noxB PE=2 SV=1 231 567 6.0E-11
sp|O81211|RBOHE_ARATH Respiratory burst oxidase homolog protein E OS=Arabidopsis thaliana GN=RBOHE PE=2 SV=2 304 503 7.0E-11
sp|Q04800|FRP1_SCHPO Ferric reductase transmembrane component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp1 PE=1 SV=1 51 530 7.0E-11
sp|P92949|FRO2_ARATH Ferric reduction oxidase 2 OS=Arabidopsis thaliana GN=FRO2 PE=1 SV=2 193 519 1.0E-10
sp|Q9SW17|RBOHG_ARATH Putative respiratory burst oxidase homolog protein G OS=Arabidopsis thaliana GN=RBOHG PE=2 SV=2 278 528 2.0E-10
sp|Q924V1|NOX4_RAT NADPH oxidase 4 OS=Rattus norvegicus GN=Nox4 PE=1 SV=2 330 551 2.0E-10
sp|Q9ES45|DUOX2_RAT Dual oxidase 2 OS=Rattus norvegicus GN=Duox2 PE=2 SV=1 321 580 3.0E-10
sp|Q9JHI8|NOX4_MOUSE NADPH oxidase 4 OS=Mus musculus GN=Nox4 PE=1 SV=1 330 551 4.0E-10
sp|Q9SBI0|RBOHB_ARATH Respiratory burst oxidase homolog protein B OS=Arabidopsis thaliana GN=RBOHB PE=2 SV=1 304 571 4.0E-10
sp|O48538|RBOHF_ARATH Respiratory burst oxidase homolog protein F OS=Arabidopsis thaliana GN=RBOHF PE=1 SV=1 278 574 8.0E-10
sp|Q9VQH2|DUOX_DROME Dual oxidase OS=Drosophila melanogaster GN=Duox PE=1 SV=2 231 549 8.0E-10
sp|Q9HBY0|NOX3_HUMAN NADPH oxidase 3 OS=Homo sapiens GN=NOX3 PE=1 SV=1 330 530 9.0E-10
sp|Q5R5C5|NOX4_PONAB NADPH oxidase 4 OS=Pongo abelii GN=NOX4 PE=2 SV=2 326 551 1.0E-09
sp|F4I4K7|FRO3_ARATH Ferric reduction oxidase 3, mitochondrial OS=Arabidopsis thaliana GN=FRO3 PE=2 SV=1 192 549 1.0E-09
sp|O61213|DUOX1_CAEEL Dual oxidase 1 OS=Caenorhabditis elegans GN=bli-3 PE=1 SV=2 278 549 1.0E-09
sp|Q96PH1|NOX5_HUMAN NADPH oxidase 5 OS=Homo sapiens GN=NOX5 PE=1 SV=1 218 552 2.0E-09
sp|Q9NPH5|NOX4_HUMAN NADPH oxidase 4 OS=Homo sapiens GN=NOX4 PE=1 SV=2 326 551 2.0E-09
sp|Q9MZF4|DUOX1_CANLF Dual oxidase 1 OS=Canis lupus familiaris GN=DUOX1 PE=1 SV=1 372 580 2.0E-09
sp|Q9NRD8|DUOX2_HUMAN Dual oxidase 2 OS=Homo sapiens GN=DUOX2 PE=1 SV=2 372 580 4.0E-09
sp|Q948U0|RBOHA_SOLTU Respiratory burst oxidase homolog protein A OS=Solanum tuberosum GN=RBOHA PE=1 SV=1 322 501 4.0E-09
sp|Q5ZAJ0|RBOHB_ORYSJ Respiratory burst oxidase homolog protein B OS=Oryza sativa subsp. japonica GN=RBOHB PE=1 SV=1 278 527 4.0E-09
sp|Q6J2K5|RBOHB_ORYSI Respiratory burst oxidase homolog protein B OS=Oryza sativa subsp. indica GN=RBOHB PE=2 SV=1 278 527 4.0E-09
sp|Q8CIZ9|NOX1_MOUSE NADPH oxidase 1 OS=Mus musculus GN=Nox1 PE=1 SV=2 330 535 4.0E-09
sp|Q2HXL0|RBOHC_SOLTU Respiratory burst oxidase homolog protein C OS=Solanum tuberosum GN=RBOHC PE=1 SV=2 278 502 7.0E-09
sp|Q8HZK3|DUOX1_PIG Dual oxidase 1 OS=Sus scrofa GN=DUOX1 PE=2 SV=1 372 580 9.0E-09
sp|Q2HXK9|RBOHD_SOLTU Respiratory burst oxidase homolog protein D OS=Solanum tuberosum GN=RBOHD PE=1 SV=2 285 527 1.0E-08
sp|Q9NRD9|DUOX1_HUMAN Dual oxidase 1 OS=Homo sapiens GN=DUOX1 PE=1 SV=1 372 580 1.0E-08
sp|P52649|CY24B_PIG Cytochrome b-245 heavy chain (Fragment) OS=Sus scrofa GN=CYBB PE=2 SV=2 329 534 2.0E-08
sp|Q672K1|NOX3_RAT NADPH oxidase 3 OS=Rattus norvegicus GN=Nox3 PE=2 SV=1 390 530 2.0E-08
sp|Q61093|CY24B_MOUSE Cytochrome b-245 heavy chain OS=Mus musculus GN=Cybb PE=1 SV=1 381 590 2.0E-08
sp|Q672J9|NOX3_MOUSE NADPH oxidase 3 OS=Mus musculus GN=Nox3 PE=1 SV=2 251 530 3.0E-08
sp|Q9WV87|NOX1_RAT NADPH oxidase 1 OS=Rattus norvegicus GN=Nox1 PE=2 SV=1 391 549 4.0E-08
sp|Q9Y5S8|NOX1_HUMAN NADPH oxidase 1 OS=Homo sapiens GN=NOX1 PE=1 SV=2 370 530 5.0E-08
sp|P04839|CY24B_HUMAN Cytochrome b-245 heavy chain OS=Homo sapiens GN=CYBB PE=1 SV=2 381 590 5.0E-08
sp|Q8CIY2|DUOX1_RAT Dual oxidase 1 OS=Rattus norvegicus GN=Duox1 PE=1 SV=1 372 580 7.0E-08
sp|Q9LMM2|FRO1_ARATH Probable ferric reduction oxidase 1 OS=Arabidopsis thaliana GN=FRO1 PE=2 SV=1 192 519 9.0E-08
sp|O46522|CY24B_BOVIN Cytochrome b-245 heavy chain OS=Bos taurus GN=CYBB PE=2 SV=1 381 590 1.0E-07
sp|Q95L74|CY24B_BISBI Cytochrome b-245 heavy chain OS=Bison bison GN=CYBB PE=2 SV=1 381 590 1.0E-07
sp|Q9SUT8|RBOHI_ARATH Probable respiratory burst oxidase homolog protein I OS=Arabidopsis thaliana GN=RBOHI PE=3 SV=2 331 574 7.0E-07
sp|Q6C188|AIM14_YARLI Probable metalloreductase AIM14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AIM14 PE=3 SV=1 193 499 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 157 179 22
3 199 221 22
4 234 256 22
5 271 293 22
6 300 322 22
7 327 349 22
8 472 494 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7938
MASHAIRAAGRLLTTLVKRIDIPLTPTSPPGLVQANVVDPWSKSGKYGLGWTYFALALVAAVMLVRIWHFWQDKI
RQAIYKQQVEEHYRNLYSLEPDPSGQHFFPDGPGLGYKQFRPKAHFASVDCVNDTLALFRWLFYRPIPDIVWRRR
RFTFSSLAVLACAFVAVAFVTLYCFLQQPLYWQSIQFGSPPLAIRAGMIAVAMTPWIIATSMKANLLTILIGIGP
ERLNVFHRWLGYLCLFLALVHMIPFYVQPVWEDGGMKVFGRLFPDGSGIIYGTGIACIVPLIWLCAASLPWIRRV
AYEVFVMLHIPAGVVYVAMLFWHTKNYLMSWGYLYATIAIWAACYLIRLFKLNWTKPWRLSFLVGDEAAITLLPE
DAIKLTIPTQMRWKPGQYVYLRMPGISLLENHPFTISSLCSEDFPSEYGECYRDCVLVFKPYRGFTKKVLDTAIA
KGPFHTYRAFLDGPYGGMRRDLAAFDTCILIAGGSGITSLMSQLLNLVKRMRDGKAITRKVMVVWAIKRFEAMDW
FREELRICQESAPPESVTCKFFLTSAVRHRPGAEMTGLATGHNPRALNHMLHDKLDGFVAGIASKRNSALIQAEA
QGDPERERELRAENEDRITALPQQKYLQPHQHPPPPSSNHLSPDDGLQHDNDGYPEEKKYATEGERQEQRAQEFH
FPPLQKENVPHFNYAPAPPRQSPVDGEGDQDSLPVRAPELAHLRRTDLSGEAAKERPVSTFGPPAGFDFGFPETP
TEFQKSLMRFAFPIPHQMDGGWTIEYGRPQLGHMLKEWATGGHDGRGILGRRTAVFVCGPPAMRVGVANTVARLQ
AEIWGDDELEEIFLHTENYAL*
Coding >Hirsu2|7938
ATGGCTTCCCACGCCATCCGCGCCGCCGGCCGCCTGCTCACCACCCTCGTCAAGCGCATCGACATTCCCTTGACG
CCTACGAGCCCGCCCGGCCTCGTCCAGGCCAACGTCGTCGATCCGTGGTCCAAGTCGGGCAAGTATGGCCTCGGC
TGGACCTACTTTGCCCTCGCCCTCGTCGCCGCCGTCATGCTCGTGCGCATCTGGCACTTTTGGCAGGACAAGATC
CGCCAGGCCATATACAAGCAGCAGGTCGAGGAGCACTACCGCAACCTCTACAGCCTCGAGCCCGACCCCTCGGGC
CAGCACTTCTTCCCCGATGGCCCCGGCCTCGGCTACAAGCAGTTCCGCCCCAAGGCGCACTTTGCCTCCGTCGAC
TGCGTCAACGACACCCTCGCCCTCTTCCGCTGGCTCTTCTACCGCCCCATCCCCGACATCGTCTGGAGACGCCGC
CGCTTCACCTTCTCCTCCCTCGCCGTCCTGGCCTGCGCCTTCGTCGCCGTCGCCTTCGTCACCCTCTACTGCTTC
CTCCAGCAGCCCCTGTACTGGCAGAGCATCCAGTTCGGCTCCCCGCCCCTGGCCATCCGCGCCGGCATGATCGCC
GTCGCCATGACGCCCTGGATCATCGCCACCAGCATGAAGGCAAACCTCCTGACCATTCTCATCGGCATCGGCCCC
GAGCGCCTCAACGTCTTTCACCGCTGGCTCGGCTACCTCTGTCTCTTTCTCGCCCTCGTCCACATGATACCCTTC
TACGTCCAGCCGGTCTGGGAGGACGGCGGCATGAAGGTCTTCGGCAGGCTGTTTCCCGACGGCAGCGGCATCATC
TACGGCACCGGTATCGCCTGCATCGTCCCGCTGATCTGGCTCTGCGCTGCGTCTCTGCCCTGGATCAGGAGGGTG
GCCTATGAGGTCTTCGTCATGCTCCACATCCCCGCCGGCGTCGTCTACGTCGCCATGCTTTTCTGGCACACCAAG
AACTACCTCATGTCGTGGGGCTACCTCTATGCCACCATCGCCATCTGGGCCGCCTGCTACCTGATACGACTCTTC
AAGCTCAACTGGACCAAGCCTTGGCGCCTGTCCTTCCTGGTCGGCGACGAAGCGGCCATCACCCTCTTGCCCGAG
GACGCCATCAAACTGACGATTCCCACGCAGATGCGGTGGAAGCCCGGGCAGTATGTCTACCTGCGCATGCCCGGC
ATCTCACTCCTCGAGAACCACCCCTTCACCATCTCGTCCCTCTGCAGCGAAGACTTCCCCTCCGAGTACGGCGAA
TGTTACCGCGACTGTGTCCTCGTCTTCAAGCCCTATCGCGGCTTCACCAAGAAGGTGCTCGACACGGCCATCGCC
AAAGGACCTTTCCACACCTACCGCGCTTTTCTGGACGGGCCCTACGGCGGCATGCGTCGGGACTTGGCGGCCTTT
GACACGTGCATCCTCATTGCCGGCGGCAGCGGCATCACCTCGCTCATGTCCCAGCTACTGAACCTCGTCAAGCGG
ATGCGGGATGGCAAGGCCATCACCCGCAAGGTCATGGTCGTCTGGGCCATCAAGCGCTTCGAGGCCATGGACTGG
TTTCGGGAGGAGCTGCGCATCTGCCAAGAGTCGGCGCCCCCGGAGAGCGTAACCTGCAAGTTCTTCCTGACCTCG
GCCGTCCGCCACCGCCCGGGGGCGGAAATGACGGGCCTCGCGACCGGGCACAATCCGAGAGCGCTGAACCACATG
CTGCACGACAAGCTGGATGGCTTTGTCGCAGGCATCGCGTCCAAGCGCAACTCGGCCCTGATCCAGGCCGAAGCC
CAGGGCGACCCCGAACGTGAACGCGAGCTTCGCGCCGAGAACGAGGACCGCATCACGGCCCTTCCGCAACAAAAA
TACCTGCAACCTCACCAGCATCCGCCCCCACCCTCCTCCAATCATTTGAGCCCCGATGACGGCCTGCAGCACGAC
AACGACGGCTATCCGGAAGAGAAGAAGTATGCGACGGAGGGTGAGCGCCAGGAGCAGCGGGCACAAGAGTTCCAC
TTCCCCCCGCTGCAGAAGGAGAATGTTCCTCATTTCAACTATGCCCCGGCGCCGCCCAGGCAGTCGCCCGTCGAC
GGCGAAGGCGACCAAGACTCGCTTCCCGTGCGTGCGCCGGAGCTGGCACACCTACGACGTACCGACCTGTCGGGG
GAGGCGGCCAAGGAACGGCCGGTGTCGACGTTCGGCCCGCCCGCCGGCTTCGATTTTGGCTTCCCGGAGACGCCG
ACCGAGTTCCAGAAAAGCCTGATGCGCTTCGCCTTCCCCATTCCGCACCAGATGGATGGTGGCTGGACGATCGAG
TACGGACGCCCGCAGCTGGGCCACATGCTCAAGGAATGGGCGACCGGTGGCCACGATGGGCGTGGCATCCTGGGG
AGGAGAACGGCCGTGTTTGTGTGTGGCCCGCCGGCGATGCGGGTCGGCGTGGCGAACACGGTGGCGCGACTGCAG
GCAGAGATATGGGGGGACGACGAGCTGGAAGAGATCTTCCTTCACACGGAGAACTACGCACTCTGA
Transcript >Hirsu2|7938
ATGGCTTCCCACGCCATCCGCGCCGCCGGCCGCCTGCTCACCACCCTCGTCAAGCGCATCGACATTCCCTTGACG
CCTACGAGCCCGCCCGGCCTCGTCCAGGCCAACGTCGTCGATCCGTGGTCCAAGTCGGGCAAGTATGGCCTCGGC
TGGACCTACTTTGCCCTCGCCCTCGTCGCCGCCGTCATGCTCGTGCGCATCTGGCACTTTTGGCAGGACAAGATC
CGCCAGGCCATATACAAGCAGCAGGTCGAGGAGCACTACCGCAACCTCTACAGCCTCGAGCCCGACCCCTCGGGC
CAGCACTTCTTCCCCGATGGCCCCGGCCTCGGCTACAAGCAGTTCCGCCCCAAGGCGCACTTTGCCTCCGTCGAC
TGCGTCAACGACACCCTCGCCCTCTTCCGCTGGCTCTTCTACCGCCCCATCCCCGACATCGTCTGGAGACGCCGC
CGCTTCACCTTCTCCTCCCTCGCCGTCCTGGCCTGCGCCTTCGTCGCCGTCGCCTTCGTCACCCTCTACTGCTTC
CTCCAGCAGCCCCTGTACTGGCAGAGCATCCAGTTCGGCTCCCCGCCCCTGGCCATCCGCGCCGGCATGATCGCC
GTCGCCATGACGCCCTGGATCATCGCCACCAGCATGAAGGCAAACCTCCTGACCATTCTCATCGGCATCGGCCCC
GAGCGCCTCAACGTCTTTCACCGCTGGCTCGGCTACCTCTGTCTCTTTCTCGCCCTCGTCCACATGATACCCTTC
TACGTCCAGCCGGTCTGGGAGGACGGCGGCATGAAGGTCTTCGGCAGGCTGTTTCCCGACGGCAGCGGCATCATC
TACGGCACCGGTATCGCCTGCATCGTCCCGCTGATCTGGCTCTGCGCTGCGTCTCTGCCCTGGATCAGGAGGGTG
GCCTATGAGGTCTTCGTCATGCTCCACATCCCCGCCGGCGTCGTCTACGTCGCCATGCTTTTCTGGCACACCAAG
AACTACCTCATGTCGTGGGGCTACCTCTATGCCACCATCGCCATCTGGGCCGCCTGCTACCTGATACGACTCTTC
AAGCTCAACTGGACCAAGCCTTGGCGCCTGTCCTTCCTGGTCGGCGACGAAGCGGCCATCACCCTCTTGCCCGAG
GACGCCATCAAACTGACGATTCCCACGCAGATGCGGTGGAAGCCCGGGCAGTATGTCTACCTGCGCATGCCCGGC
ATCTCACTCCTCGAGAACCACCCCTTCACCATCTCGTCCCTCTGCAGCGAAGACTTCCCCTCCGAGTACGGCGAA
TGTTACCGCGACTGTGTCCTCGTCTTCAAGCCCTATCGCGGCTTCACCAAGAAGGTGCTCGACACGGCCATCGCC
AAAGGACCTTTCCACACCTACCGCGCTTTTCTGGACGGGCCCTACGGCGGCATGCGTCGGGACTTGGCGGCCTTT
GACACGTGCATCCTCATTGCCGGCGGCAGCGGCATCACCTCGCTCATGTCCCAGCTACTGAACCTCGTCAAGCGG
ATGCGGGATGGCAAGGCCATCACCCGCAAGGTCATGGTCGTCTGGGCCATCAAGCGCTTCGAGGCCATGGACTGG
TTTCGGGAGGAGCTGCGCATCTGCCAAGAGTCGGCGCCCCCGGAGAGCGTAACCTGCAAGTTCTTCCTGACCTCG
GCCGTCCGCCACCGCCCGGGGGCGGAAATGACGGGCCTCGCGACCGGGCACAATCCGAGAGCGCTGAACCACATG
CTGCACGACAAGCTGGATGGCTTTGTCGCAGGCATCGCGTCCAAGCGCAACTCGGCCCTGATCCAGGCCGAAGCC
CAGGGCGACCCCGAACGTGAACGCGAGCTTCGCGCCGAGAACGAGGACCGCATCACGGCCCTTCCGCAACAAAAA
TACCTGCAACCTCACCAGCATCCGCCCCCACCCTCCTCCAATCATTTGAGCCCCGATGACGGCCTGCAGCACGAC
AACGACGGCTATCCGGAAGAGAAGAAGTATGCGACGGAGGGTGAGCGCCAGGAGCAGCGGGCACAAGAGTTCCAC
TTCCCCCCGCTGCAGAAGGAGAATGTTCCTCATTTCAACTATGCCCCGGCGCCGCCCAGGCAGTCGCCCGTCGAC
GGCGAAGGCGACCAAGACTCGCTTCCCGTGCGTGCGCCGGAGCTGGCACACCTACGACGTACCGACCTGTCGGGG
GAGGCGGCCAAGGAACGGCCGGTGTCGACGTTCGGCCCGCCCGCCGGCTTCGATTTTGGCTTCCCGGAGACGCCG
ACCGAGTTCCAGAAAAGCCTGATGCGCTTCGCCTTCCCCATTCCGCACCAGATGGATGGTGGCTGGACGATCGAG
TACGGACGCCCGCAGCTGGGCCACATGCTCAAGGAATGGGCGACCGGTGGCCACGATGGGCGTGGCATCCTGGGG
AGGAGAACGGCCGTGTTTGTGTGTGGCCCGCCGGCGATGCGGGTCGGCGTGGCGAACACGGTGGCGCGACTGCAG
GCAGAGATATGGGGGGACGACGAGCTGGAAGAGATCTTCCTTCACACGGAGAACTACGCACTCTGA
Gene >Hirsu2|7938
ATGGCTTCCCACGCCATCCGCGCCGCCGGCCGCCTGCTCACCACCCTCGTCAAGCGCATCGACATTCCCTTGACG
CCTACGAGCCCGCCCGGCCTCGTCCAGGCCAACGTCGTCGATCCGTGGTCCAAGTCGGGCAAGTATGGCCTCGGC
TGGACCTACTTTGCCCTCGCCCTCGTCGCCGCCGTCATGCTCGTGCGCATCTGGCACTTTTGGCAGGACAAGATC
CGCCAGGCCATATACAAGCAGCAGGTCGAGGAGCACTACCGCAACCTCTACAGCCTCGAGCCCGACCCCTCGGGC
CAGCACTTCTTCCCCGATGGCCCCGGCCTCGGCTACAAGCAGTTCCGCCCCAAGGCGCACTTTGCCTCCGTCGAC
TGCGTCAACGACACCCTCGCCCTCTTCCGCTGGCTCTTCTACCGCCCCATCCCCGACATCGTCTGGAGACGCCGC
CGCTTCACCTTCTCCTCCCTCGCCGTCCTGGCCTGCGCCTTCGTCGCCGTCGCCTTCGTCACCCTCTACTGCTTC
CTCCAGCAGCCCCTGTACTGGCAGAGCATCCAGTTCGGCTCCCCGCCCCTGGCCATCCGCGCCGGCATGATCGCC
GTCGCCATGACGCCCTGGATCATCGCCACCAGCATGAAGGCAAACCTCCTGACCATTCTCATCGGCATCGGCCCC
GAGCGCCTCAACGTCTTTCACCGCTGGCTCGGCTACCTCTGTCTCTTTCTCGCCCTCGTCCACATGATACCCTTC
TACGTCCAGCCGGTCTGGGAGGACGGCGGCATGAAGGTCTTCGGCAGGCTGTTTCCCGACGGCAGCGGCATCATC
TACGGCACCGGTATCGCCTGCATCGTCCCGCTGATCTGGCTCTGCGCTGCGTCTCTGCCCTGGATCAGGAGGGTG
GCCTATGAGGTCTTCGTCATGCTCCACATCCCCGCCGGCGTCGTCTACGTCGCCATGCTTTTCTGGCACACCAAG
AACTACCTCATGTCGTGGGGCTACCTCTATGCCACCATCGCCATCTGGGCCGCCTGCTACCTGATACGACTCTTC
AAGCTCAACTGGACCAAGCCTTGGCGCCTGTCCTTCCTGGTCGGCGACGAAGCGGCCATCACCCTCTTGCCCGAG
GACGCCATCAAACTGACGATTCCCACGCAGATGCGGTGGAAGCCCGGGCAGTATGTCTACCTGCGCATGCCCGGC
ATCTCACTCCTCGAGAACCACCCCTTCACCATCTCGTCCCTCTGCAGCGAAGACTTCCCCTCCGAGTACGGCGAA
TGTTACCGCGACTGTGTCCTCGTCTTCAAGCCCTATCGCGGCTTCACCAAGAAGGTGCTCGACACGGCCATCGCC
AAAGGACCTTTCCACACCTACCGCGCTTTTCTGGACGGGCCCTACGGCGGCATGCGTCGGGACTTGGCGGCCTTT
GACACGTGCATCCTCATTGCCGGCGGCAGCGGCATCACCTCGCTCATGTCCCAGCTACTGAACCTCGTCAAGCGG
ATGCGGGATGGCAAGGCCATCACCCGCAAGGTCATGGTCGTCTGGGCCATCAAGCGCTTCGAGGCCATGGACTGG
TTTCGGGAGGAGCTGCGCATCTGCCAAGAGTCGGCGCCCCCGGAGAGCGTAACCTGCAAGTTCTTCCTGACCTCG
GCCGTCCGCCACCGCCCGGGGGCGGAAATGACGGGCCTCGCGACCGGGCACAATCCGAGAGCGCTGAACCACATG
CTGCACGACAAGCTGGATGGCTTTGTCGCAGGCATCGCGTCCAAGCGCAACTCGGCCCTGATCCAGGCCGAAGCC
CAGGGCGACCCCGAACGTGAACGCGAGCTTCGCGCCGAGAACGAGGACCGCATCACGGCCCTTCCGCAACAAAAA
TACCTGCAACCTCACCAGCATCCGCCCCCACCCTCCTCCAATCATTTGAGCCCCGATGACGGCCTGCAGCACGAC
AACGACGGCTATCCGGAAGAGAAGAAGTATGCGACGGAGGGTGAGCGCCAGGAGCAGCGGGCACAAGAGTTCCAC
TTCCCCCCGCTGCAGAAGGAGAATGTTCCTCATTTCAACTATGCCCCGGCGCCGCCCAGGCAGTCGCCCGTCGAC
GGCGAAGGCGACCAAGACTCGCTTCCCGTGCGTGCGCCGGAGCTGGCACACCTACGACGTACCGACCTGTCGGGG
GAGGCGGCCAAGGAACGGCCGGTGTCGACGTTCGGCCCGCCCGCCGGCTTCGATTTTGGCTTCCCGGAGACGCCG
ACCGAGTTCCAGAAAAGCCTGATGCGCTTCGCCTTCCCCATTCCGCACCAGATGGATGGTGGCTGGACGATCGAG
TACGGACGCCCGCAGCTGGGCCACATGCTCAAGGAATGGGCGACCGGTGGCCACGATGGGCGTGGCATCCTGGGG
AGGAGAACGGCCGTGTTTGTGTGTGGCCCGCCGGCGATGCGGGTCGGCGTGGCGAACACGGTGGCGCGACTGCAG
GCAGAGATATGGGGGGACGACGAGCTGGAAGAGATCTTCCTTCACACGGAGAACTACGCACTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail