Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7935
Gene name
LocationContig_490:2196..4620
Strand-
Gene length (bp)2424
Transcript length (bp)2145
Coding sequence length (bp)2145
Protein length (aa) 715

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01585 G-patch G-patch domain 3.0E-09 633 676
PF00641 zf-RanBP Zn-finger in Ran binding protein and others 2.5E-06 210 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87143|YDMD_SCHPO Uncharacterized RNA-binding protein C57A7.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.13 PE=3 SV=1 82 680 4.0E-28
sp|Q99KG3|RBM10_MOUSE RNA-binding protein 10 OS=Mus musculus GN=Rbm10 PE=1 SV=1 516 681 6.0E-14
sp|P98175|RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 516 681 7.0E-14
sp|P70501|RBM10_RAT RNA-binding protein 10 OS=Rattus norvegicus GN=Rbm10 PE=1 SV=1 516 681 7.0E-14
sp|A4IGK4|RBM5_XENTR RNA-binding protein 5 OS=Xenopus tropicalis GN=rbm5 PE=2 SV=1 516 714 5.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87143|YDMD_SCHPO Uncharacterized RNA-binding protein C57A7.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.13 PE=3 SV=1 82 680 4.0E-28
sp|Q99KG3|RBM10_MOUSE RNA-binding protein 10 OS=Mus musculus GN=Rbm10 PE=1 SV=1 516 681 6.0E-14
sp|P98175|RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 516 681 7.0E-14
sp|P70501|RBM10_RAT RNA-binding protein 10 OS=Rattus norvegicus GN=Rbm10 PE=1 SV=1 516 681 7.0E-14
sp|A4IGK4|RBM5_XENTR RNA-binding protein 5 OS=Xenopus tropicalis GN=rbm5 PE=2 SV=1 516 714 5.0E-13
sp|Q1RMU5|RBM5_BOVIN RNA-binding protein 5 OS=Bos taurus GN=RBM5 PE=2 SV=1 517 681 3.0E-11
sp|P52756|RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 517 681 3.0E-11
sp|Q91YE7|RBM5_MOUSE RNA-binding protein 5 OS=Mus musculus GN=Rbm5 PE=1 SV=1 517 681 3.0E-11
sp|B2GV05|RBM5_RAT RNA-binding protein 5 OS=Rattus norvegicus GN=Rbm5 PE=1 SV=1 517 681 3.0E-11
sp|A0JMV4|RBM5A_XENLA RNA-binding protein 5-A OS=Xenopus laevis GN=rbm5-a PE=2 SV=1 516 714 1.0E-10
sp|A4IGK4|RBM5_XENTR RNA-binding protein 5 OS=Xenopus tropicalis GN=rbm5 PE=2 SV=1 20 254 2.0E-08
sp|Q6DDU9|RBM5B_XENLA RNA-binding protein 5-B OS=Xenopus laevis GN=rbm5-b PE=2 SV=1 587 714 1.0E-07
sp|Q6DDU9|RBM5B_XENLA RNA-binding protein 5-B OS=Xenopus laevis GN=rbm5-b PE=2 SV=1 20 254 2.0E-07
sp|A0JMV4|RBM5A_XENLA RNA-binding protein 5-A OS=Xenopus laevis GN=rbm5-a PE=2 SV=1 101 254 2.0E-06
sp|P78332|RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens GN=RBM6 PE=1 SV=5 513 677 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7935
MERGRDYDDRYRGREDEYWHRRDGDFRRSRYDDRREHDYQGMYDDYTRSDDDRRRSRTRTRDPGDFERGDDYRHH
HHDDHGRGHRPRSASRSRTRDAGRPSDTVILEGLPHGVPTSAIRRGLFDSSIAGDFSSVDVRVTASRGNCRAFVQ
FATVEDASAFVKQHFPKLLICLPHSTDDVPDGKFTADIHFARSQGYGDAPQTSPATPAADWACPTCGYFNFASRS
RCKKCSGPSTAEAGDVGRTGAADVGRDVDQKVQILVVYPLPPDIDEQKLASEMKRLELVKQEKPKDEAPKLKSTA
PSADGAGFGARPGSLHRVFLMRDLATGEKFPYGFAEFWTLNDALSALKKYQMTRSFEIANTPVTIASIHLGVFVP
EYREVTPELEDTSFKPLFNPSLRVKYRDPELYPSQLVVAATAPEDDEAVKAAKEKTEGQKPKKRKAEESLPESAT
KKAPVMAAQMAFWQRRHEEIRGGGPQEGAPQSSAANGPSRTAPIKFSLSGATTKPGSAVAKAPRVSEEPEKRVET
ETAEVSYVDRERLACLLCMMRYKSVEDVNTHEKSGNHKRAMQDEEKVQAALPRLAARDKRRQKAEAAQYRDRAKE
RREAHNQPDKPKASKPKAEGKPQAKEEAKKPAESKGAGMLAKMGWTSGNGLGAQGDGLTEALTASAYKGGVGLGV
EGGKLGDAAEVAESRTTDSYSSYLTAAQQKARERYNQME*
Coding >Hirsu2|7935
ATGGAGCGTGGGAGAGACTATGACGACCGCTATCGCGGCCGAGAGGATGAGTACTGGCATCGCCGGGACGGCGAC
TTCCGCCGCTCGCGTTATGATGACCGAAGAGAGCACGACTACCAGGGCATGTATGATGATTATACCCGAAGCGAC
GATGACCGCCGTCGCTCGCGCACCCGCACCCGGGACCCCGGAGACTTTGAGCGCGGCGATGACTACAGACACCAT
CATCACGACGACCATGGGCGTGGGCACCGCCCCAGAAGCGCCTCTCGCAGCCGAACTCGCGACGCGGGCCGGCCA
TCCGACACTGTGATACTGGAGGGCCTCCCGCACGGCGTGCCGACCAGTGCTATCCGCCGGGGCCTTTTTGACAGC
TCCATTGCTGGCGACTTCTCTTCGGTCGACGTGCGAGTGACAGCTTCACGAGGTAACTGCCGGGCTTTCGTCCAA
TTCGCAACAGTCGAAGACGCCAGCGCATTCGTCAAGCAGCACTTCCCAAAACTCTTGATCTGTTTGCCGCATTCC
ACTGATGACGTGCCAGATGGCAAGTTTACCGCAGACATCCACTTCGCCCGCAGCCAGGGCTATGGGGATGCCCCC
CAAACCTCACCGGCTACGCCCGCTGCCGACTGGGCCTGCCCCACGTGCGGTTACTTCAACTTCGCCTCGCGAAGT
AGGTGCAAGAAGTGCTCCGGCCCCTCAACAGCTGAGGCAGGAGACGTCGGCCGCACAGGGGCCGCAGATGTCGGC
AGAGATGTCGATCAAAAGGTCCAGATCCTCGTCGTTTACCCCCTGCCGCCAGACATCGACGAACAGAAGCTGGCA
AGCGAGATGAAACGGCTCGAGCTCGTCAAGCAGGAGAAACCAAAGGACGAGGCCCCCAAACTGAAGTCGACGGCT
CCTTCTGCCGATGGTGCGGGCTTCGGGGCGAGACCAGGCTCGCTTCACCGTGTGTTCCTCATGCGCGACCTTGCC
ACGGGCGAAAAGTTCCCATACGGCTTCGCCGAATTCTGGACGCTCAACGACGCGCTTTCAGCCCTCAAGAAGTAC
CAGATGACACGCTCCTTTGAGATTGCCAACACGCCGGTCACGATCGCATCGATTCATCTGGGCGTGTTTGTTCCA
GAGTATCGGGAGGTTACGCCGGAACTCGAAGACACGTCTTTCAAGCCCCTCTTCAACCCTTCGCTACGGGTCAAG
TATCGAGACCCCGAGCTCTACCCCAGCCAGCTCGTGGTTGCGGCCACAGCCCCGGAGGATGACGAGGCTGTCAAG
GCGGCCAAGGAGAAGACGGAGGGTCAGAAGCCCAAGAAGCGCAAGGCAGAGGAGAGCCTGCCCGAATCGGCGACG
AAGAAGGCGCCGGTGATGGCGGCGCAGATGGCATTCTGGCAGCGCCGACACGAGGAGATTCGAGGCGGTGGGCCC
CAGGAAGGCGCGCCGCAGAGCTCGGCCGCCAACGGCCCGTCGCGGACGGCGCCCATCAAATTCTCGCTGTCGGGG
GCGACGACCAAGCCGGGTTCGGCGGTCGCCAAGGCGCCGCGCGTCAGCGAAGAGCCGGAGAAGCGAGTGGAGACG
GAGACGGCCGAGGTCTCGTACGTGGACCGCGAGCGCCTCGCATGCCTCCTGTGCATGATGCGCTACAAATCCGTC
GAGGATGTCAACACGCACGAGAAGTCGGGAAACCACAAGAGGGCGATGCAGGACGAGGAGAAGGTCCAGGCGGCC
CTGCCGCGGCTCGCAGCCCGGGATAAGCGGCGTCAGAAGGCCGAGGCGGCGCAGTACCGCGACCGAGCCAAGGAG
AGACGAGAGGCGCATAATCAGCCGGACAAGCCCAAGGCGAGCAAGCCGAAGGCCGAGGGCAAGCCGCAGGCCAAG
GAGGAAGCGAAGAAGCCGGCCGAATCGAAGGGGGCCGGGATGCTGGCCAAGATGGGCTGGACGTCGGGCAACGGC
CTCGGCGCGCAGGGTGACGGGCTTACGGAGGCGCTCACGGCCAGCGCGTACAAGGGCGGTGTTGGCCTCGGCGTC
GAGGGGGGGAAGCTGGGAGACGCGGCCGAGGTGGCCGAGAGCCGAACGACGGACAGTTATTCGAGCTACCTGACG
GCGGCGCAGCAAAAGGCGCGGGAGCGCTACAACCAGATGGAGTAG
Transcript >Hirsu2|7935
ATGGAGCGTGGGAGAGACTATGACGACCGCTATCGCGGCCGAGAGGATGAGTACTGGCATCGCCGGGACGGCGAC
TTCCGCCGCTCGCGTTATGATGACCGAAGAGAGCACGACTACCAGGGCATGTATGATGATTATACCCGAAGCGAC
GATGACCGCCGTCGCTCGCGCACCCGCACCCGGGACCCCGGAGACTTTGAGCGCGGCGATGACTACAGACACCAT
CATCACGACGACCATGGGCGTGGGCACCGCCCCAGAAGCGCCTCTCGCAGCCGAACTCGCGACGCGGGCCGGCCA
TCCGACACTGTGATACTGGAGGGCCTCCCGCACGGCGTGCCGACCAGTGCTATCCGCCGGGGCCTTTTTGACAGC
TCCATTGCTGGCGACTTCTCTTCGGTCGACGTGCGAGTGACAGCTTCACGAGGTAACTGCCGGGCTTTCGTCCAA
TTCGCAACAGTCGAAGACGCCAGCGCATTCGTCAAGCAGCACTTCCCAAAACTCTTGATCTGTTTGCCGCATTCC
ACTGATGACGTGCCAGATGGCAAGTTTACCGCAGACATCCACTTCGCCCGCAGCCAGGGCTATGGGGATGCCCCC
CAAACCTCACCGGCTACGCCCGCTGCCGACTGGGCCTGCCCCACGTGCGGTTACTTCAACTTCGCCTCGCGAAGT
AGGTGCAAGAAGTGCTCCGGCCCCTCAACAGCTGAGGCAGGAGACGTCGGCCGCACAGGGGCCGCAGATGTCGGC
AGAGATGTCGATCAAAAGGTCCAGATCCTCGTCGTTTACCCCCTGCCGCCAGACATCGACGAACAGAAGCTGGCA
AGCGAGATGAAACGGCTCGAGCTCGTCAAGCAGGAGAAACCAAAGGACGAGGCCCCCAAACTGAAGTCGACGGCT
CCTTCTGCCGATGGTGCGGGCTTCGGGGCGAGACCAGGCTCGCTTCACCGTGTGTTCCTCATGCGCGACCTTGCC
ACGGGCGAAAAGTTCCCATACGGCTTCGCCGAATTCTGGACGCTCAACGACGCGCTTTCAGCCCTCAAGAAGTAC
CAGATGACACGCTCCTTTGAGATTGCCAACACGCCGGTCACGATCGCATCGATTCATCTGGGCGTGTTTGTTCCA
GAGTATCGGGAGGTTACGCCGGAACTCGAAGACACGTCTTTCAAGCCCCTCTTCAACCCTTCGCTACGGGTCAAG
TATCGAGACCCCGAGCTCTACCCCAGCCAGCTCGTGGTTGCGGCCACAGCCCCGGAGGATGACGAGGCTGTCAAG
GCGGCCAAGGAGAAGACGGAGGGTCAGAAGCCCAAGAAGCGCAAGGCAGAGGAGAGCCTGCCCGAATCGGCGACG
AAGAAGGCGCCGGTGATGGCGGCGCAGATGGCATTCTGGCAGCGCCGACACGAGGAGATTCGAGGCGGTGGGCCC
CAGGAAGGCGCGCCGCAGAGCTCGGCCGCCAACGGCCCGTCGCGGACGGCGCCCATCAAATTCTCGCTGTCGGGG
GCGACGACCAAGCCGGGTTCGGCGGTCGCCAAGGCGCCGCGCGTCAGCGAAGAGCCGGAGAAGCGAGTGGAGACG
GAGACGGCCGAGGTCTCGTACGTGGACCGCGAGCGCCTCGCATGCCTCCTGTGCATGATGCGCTACAAATCCGTC
GAGGATGTCAACACGCACGAGAAGTCGGGAAACCACAAGAGGGCGATGCAGGACGAGGAGAAGGTCCAGGCGGCC
CTGCCGCGGCTCGCAGCCCGGGATAAGCGGCGTCAGAAGGCCGAGGCGGCGCAGTACCGCGACCGAGCCAAGGAG
AGACGAGAGGCGCATAATCAGCCGGACAAGCCCAAGGCGAGCAAGCCGAAGGCCGAGGGCAAGCCGCAGGCCAAG
GAGGAAGCGAAGAAGCCGGCCGAATCGAAGGGGGCCGGGATGCTGGCCAAGATGGGCTGGACGTCGGGCAACGGC
CTCGGCGCGCAGGGTGACGGGCTTACGGAGGCGCTCACGGCCAGCGCGTACAAGGGCGGTGTTGGCCTCGGCGTC
GAGGGGGGGAAGCTGGGAGACGCGGCCGAGGTGGCCGAGAGCCGAACGACGGACAGTTATTCGAGCTACCTGACG
GCGGCGCAGCAAAAGGCGCGGGAGCGCTACAACCAGATGGAGTAG
Gene >Hirsu2|7935
ATGGAGCGTGGGAGAGACTATGACGACCGCTATCGCGGCCGAGAGGATGAGTACTGGCATCGCCGGGACGGCGAC
TTCCGCCGCTCGCGTTATGATGACCGAAGAGAGCACGACTACCAGGGCATGTATGATGATTATACCCGAAGCGAC
GATGACCGCCGTCGCTCGCGCACCCGCACCCGGGACCCCGGAGACTTTGAGCGCGGCGATGACTACAGACACCAT
CATCACGACGACCATGGGCGTGGGCACCGCCCCAGAAGCGCCTCTCGCAGCCGAACTCGCGACGCGGGCCGGCCA
TCCGACACTGTGATACTGGAGGGCCTCCCGCACGGCGTGCCGACCAGTGCTGTGAGCATTCTCTCTCCGCCACCG
GACTTTTTTTTTTTTTTTTTCAAATGTTTTTGGACGCGTCGAAGCTGACTGTACATTGTGTCGCAGATCCGCCGG
GGCCTTTTTGACAGCTCCATTGCTGGCGACTTCTCTTCGGTCGACGTGCGAGTGACAGCTTCACGAGGTCAGTGT
CTCTTGTTTCTCCTCCTCTCCTCGGCGCCGCCCGTCTAACTGGTGACCAGGTAACTGCCGGGCTTTCGTCCAATT
CGCAACAGTCGAAGACGCCAGCGCATTCGTCAAGCAGCACTTCCCAAAACTCTTGATCTGTTTGCCGCATTCCAC
TGATGACGTGCCAGATGGCAAGTTTACCGCAGACATCCACTTCGCCCGCAGCCAGGGCTATGGGGATGCCCCCCA
AACCTCACCGGCTACGCCCGCTGCCGACTGGGCCTGCCCCACGGTAAGAACCCCTTGAGAAGCCTTCAGGTGCCG
CCGTTCGAGCAGGTCTGACTGACTCGTTTGCAGTGCGGTTACTTCAACTTCGCCTCGCGAAGTAGGTGCAAGAAG
TGCTCCGGCCCCTCAACAGGTACTACTTCCAGAGCCGCTCGCAGACGCGCATGGAAGCAGACTCGCTTACAATAT
CCGCGCGCAGCTGAGGCAGGAGACGTCGGCCGCACAGGGGCCGCAGATGTCGGCAGAGATGTCGATCAAAAGGTC
CAGATCCTCGTCGTTTACCCCCTGCCGCCAGACATCGACGAACAGAAGCTGGCAAGCGAGATGAAACGGCTCGAG
CTCGTCAAGCAGGAGAAACCAAAGGACGAGGCCCCCAAACTGAAGTCGACGGCTCCTTCTGCCGATGGTGCGGGC
TTCGGGGCGAGACCAGGCTCGCTTCACCGTGTGTTCCTCATGCGCGACCTTGCCACGGGCGAAAAGTTCCCATAC
GGCTTCGCCGAATTCTGGACGCTCAACGACGCGCTTTCAGCCCTCAAGAAGTACCAGATGACACGCTCCTTTGAG
ATTGCCAACACGCCGGTCACGATCGCATCGATTCATCTGGGCGTGTTTGTTCCAGAGTATCGGGAGGTTACGCCG
GAACTCGAAGACACGTCTTTCAAGCCCCTCTTCAACCCTTCGCTACGGGTCAAGTATCGAGACCCCGAGCTCTAC
CCCAGCCAGCTCGTGGTTGCGGCCACAGCCCCGGAGGATGACGAGGCTGTCAAGGCGGCCAAGGAGAAGACGGAG
GGTCAGAAGCCCAAGAAGCGCAAGGCAGAGGAGAGCCTGCCCGAATCGGCGACGAAGAAGGCGCCGGTGATGGCG
GCGCAGATGGCATTCTGGCAGCGCCGACACGAGGAGATTCGAGGCGGTGGGCCCCAGGAAGGCGCGCCGCAGAGC
TCGGCCGCCAACGGCCCGTCGCGGACGGCGCCCATCAAATTCTCGCTGTCGGGGGCGACGACCAAGCCGGGTTCG
GCGGTCGCCAAGGCGCCGCGCGTCAGCGAAGAGCCGGAGAAGCGAGTGGAGACGGAGACGGCCGAGGTCTCGTAC
GTGGACCGCGAGCGCCTCGCATGCCTCCTGTGCATGATGCGCTACAAATCCGTCGAGGATGTCAACACGCACGAG
AAGTCGGGAAACCACAAGAGGGCGATGCAGGACGAGGAGAAGGTCCAGGCGGCCCTGCCGCGGCTCGCAGCCCGG
GATAAGCGGCGTCAGAAGGCCGAGGCGGCGCAGTACCGCGACCGAGCCAAGGAGAGACGAGAGGCGCATAATCAG
CCGGACAAGCCCAAGGCGAGCAAGCCGAAGGCCGAGGGCAAGCCGCAGGCCAAGGAGGAAGCGAAGAAGCCGGCC
GAATCGAAGGGGGCCGGGATGCTGGCCAAGATGGGCTGGACGTCGGGCAACGGCCTCGGCGCGCAGGGTGACGGG
CTTACGGAGGCGCTCACGGCCAGCGCGTACAAGGGCGGTGTTGGCCTCGGCGTCGAGGGGGGGAAGCTGGGAGAC
GCGGCCGAGGTGGCCGAGAGCCGAACGACGGACAGTTATTCGAGCTACCTGACGGCGGCGCAGCAAAAGGCGCGG
GAGCGCTACAACCAGATGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail