Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7934
Gene name
LocationContig_490:21..1349
Strand+
Gene length (bp)1328
Transcript length (bp)1110
Coding sequence length (bp)1110
Protein length (aa) 370

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 3.4E-36 5 309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 5 336 6.0E-40
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 5 336 7.0E-40
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 5 346 2.0E-36
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 5 346 2.0E-36
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 5 356 3.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 5 336 6.0E-40
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 5 336 7.0E-40
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 5 346 2.0E-36
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 5 346 2.0E-36
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 5 356 3.0E-33
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 3 311 3.0E-29
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 5 322 4.0E-28
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 5 322 1.0E-27
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 5 322 2.0E-27
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 5 322 7.0E-27
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 5 322 8.0E-26
sp|P0CY28|CARP3_CANAX Candidapepsin-3 OS=Candida albicans GN=SAP3 PE=1 SV=1 5 308 1.0E-25
sp|P0CY29|CARP3_CANAL Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP3 PE=1 SV=1 5 308 1.0E-25
sp|P32951|CARP1_CANPA Candidapepsin-1 OS=Candida parapsilosis GN=SAPP1 PE=1 SV=1 1 322 3.0E-25
sp|C4YNQ5|CARP3_CANAW Candidapepsin-3 OS=Candida albicans (strain WO-1) GN=SAP3 PE=1 SV=1 5 308 3.0E-25
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 5 319 2.0E-24
sp|Q00663|CARP_CANTR Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 5 314 3.0E-23
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 5 308 2.0E-22
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 5 308 2.0E-22
sp|C4YMJ3|CARP2_CANAW Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 5 322 3.0E-22
sp|P0CS83|CARP2_CANAX Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 5 322 2.0E-21
sp|P0DJ06|CARP2_CANAL Candidapepsin-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP2 PE=1 SV=1 5 322 5.0E-21
sp|C4YSF6|CARP1_CANAW Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 5 308 1.0E-20
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 5 308 3.0E-20
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 5 308 3.0E-20
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 70 323 3.0E-20
sp|P53379|MKC7_YEAST Aspartic proteinase MKC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKC7 PE=1 SV=2 5 323 4.0E-20
sp|Q59SU1|CARP9_CANAL Candidapepsin-9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP9 PE=1 SV=1 5 317 9.0E-20
sp|O42779|CARP9_CANAX Candidapepsin-9 OS=Candida albicans GN=SAP9 PE=3 SV=1 5 317 2.0E-19
sp|P32950|CARP2_CANPA Candidapepsin-2 OS=Candida parapsilosis GN=SAPP2 PE=1 SV=1 7 295 1.0E-18
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 5 318 5.0E-17
sp|Q59VH7|CARP7_CANAL Candidapepsin-7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP7 PE=1 SV=1 5 323 5.0E-17
sp|Q5A651|CAR10_CANAL Candidapepsin-10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP10 PE=1 SV=1 5 319 6.0E-17
sp|P40583|YPS6_YEAST Aspartic proteinase yapsin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS6 PE=1 SV=1 5 322 2.0E-16
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 22 310 2.0E-15
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 22 310 6.0E-15
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 22 310 2.0E-14
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 22 309 3.0E-14
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 22 312 1.0E-13
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 22 310 2.0E-13
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 22 310 3.0E-13
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 22 310 4.0E-13
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 22 309 4.0E-13
sp|Q805F2|CATEB_XENLA Cathepsin E-B OS=Xenopus laevis GN=ctse-b PE=2 SV=1 22 312 7.0E-13
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 5 309 7.0E-13
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 22 312 7.0E-13
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 14 311 9.0E-13
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 14 311 1.0E-12
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 22 309 1.0E-12
sp|P56272|PEP2B_GADMO Pepsin-2B OS=Gadus morhua PE=1 SV=1 21 310 2.0E-12
sp|Q805F3|CATEA_XENLA Cathepsin E-A OS=Xenopus laevis GN=ctse-a PE=1 SV=1 22 312 2.0E-12
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 22 309 2.0E-12
sp|Q28057|PAG2_BOVIN Pregnancy-associated glycoprotein 2 OS=Bos taurus GN=PAG2 PE=2 SV=1 15 310 5.0E-12
sp|Q689Z7|PEPC_MONDO Gastricsin OS=Monodelphis domestica GN=PGC PE=2 SV=1 22 308 6.0E-12
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 22 309 7.0E-12
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 22 309 8.0E-12
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 22 309 8.0E-12
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 22 309 1.0E-11
sp|P43096|CARP7_CANAX Candidapepsin-7 OS=Candida albicans GN=SAP7 PE=3 SV=1 5 323 1.0E-11
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 22 309 1.0E-11
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 5 263 1.0E-11
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 22 309 2.0E-11
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 22 312 2.0E-11
sp|P03954|PEPA1_MACFU Pepsin A-1 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=2 22 309 3.0E-11
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 5 309 4.0E-11
sp|Q9N2D4|PEPA_CALJA Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 22 309 6.0E-11
sp|Q29078|PAG1_PIG Pregnancy-associated glycoprotein 1 OS=Sus scrofa PE=2 SV=1 22 307 6.0E-11
sp|P27678|PEPA4_MACFU Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 22 309 9.0E-11
sp|P41748|PEPA_ASPFU Aspartic protease pep1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep1 PE=1 SV=2 5 309 1.0E-10
sp|B0Y1V8|PEPA_ASPFC Aspartic protease pep1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pep1 PE=3 SV=1 5 309 1.0E-10
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 5 309 2.0E-10
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 22 309 2.0E-10
sp|O59774|YPS1_SCHPO Aspartic proteinase yapsin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yps1 PE=3 SV=1 20 345 3.0E-10
sp|Q29079|PAG2_PIG Pregnancy-associated glycoprotein 2 OS=Sus scrofa GN=PAG2 PE=2 SV=1 24 310 7.0E-10
sp|P27821|PEPA2_RABIT Pepsin II-2/3 OS=Oryctolagus cuniculus PE=2 SV=1 22 310 7.0E-10
sp|O76856|CATD_DICDI Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 21 310 7.0E-10
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 5 309 1.0E-09
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 5 308 1.0E-09
sp|P28713|PEPA4_RABIT Pepsin II-4 OS=Oryctolagus cuniculus PE=2 SV=1 22 310 1.0E-09
sp|O42630|CARP_ASPFU Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 30 310 1.0E-09
sp|P32834|SXA1_SCHPO Aspartic proteinase sxa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sxa1 PE=3 SV=2 4 358 2.0E-09
sp|A1DDK1|PEPA_NEOFI Aspartic protease pep1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pep1 PE=3 SV=1 5 309 2.0E-09
sp|Q8VYL3|APA2_ARATH Aspartic proteinase A2 OS=Arabidopsis thaliana GN=APA2 PE=2 SV=1 14 198 2.0E-09
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 11 311 3.0E-09
sp|Q42456|ASPR1_ORYSJ Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2 14 198 4.0E-09
sp|P83495|PAG4_SHEEP Pregnancy-associated glycoprotein 4 OS=Ovis aries PE=1 SV=2 14 310 5.0E-09
sp|Q800A0|CATE_LITCT Cathepsin E OS=Lithobates catesbeiana GN=CTSE PE=1 SV=1 22 310 6.0E-09
sp|P00798|PENP_PENJA Penicillopepsin OS=Penicillium janthinellum PE=1 SV=2 5 309 1.0E-08
sp|P27823|PEPAF_RABIT Pepsin F OS=Oryctolagus cuniculus PE=2 SV=1 22 310 1.0E-08
sp|Q9XEC4|APA3_ARATH Aspartic proteinase A3 OS=Arabidopsis thaliana GN=APA3 PE=1 SV=1 15 203 2.0E-08
sp|P43159|CATE_RABIT Cathepsin E OS=Oryctolagus cuniculus GN=CTSE PE=2 SV=1 22 312 2.0E-08
sp|Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 OS=Bos taurus PE=1 SV=1 5 310 2.0E-08
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 14 311 2.0E-08
sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein OS=Equus caballus GN=PAG PE=2 SV=1 22 310 3.0E-08
sp|P78735|PEPA_PENJA Aspartic protease pepA OS=Penicillium janthinellum GN=pepA PE=1 SV=1 2 309 5.0E-08
sp|P81214|CARP_SYNRA Syncephapepsin OS=Syncephalastrum racemosum GN=SPSR PE=1 SV=1 5 311 7.0E-08
sp|O09043|NAPSA_MOUSE Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1 10 194 8.0E-08
sp|P16476|PEPE_CHICK Embryonic pepsinogen OS=Gallus gallus PE=2 SV=1 14 310 4.0E-07
sp|P06281|RENI1_MOUSE Renin-1 OS=Mus musculus GN=Ren1 PE=1 SV=1 5 310 5.0E-07
sp|P10602|CARP1_RHINI Rhizopuspepsin-1 OS=Rhizopus niveus GN=RNAP PE=1 SV=1 5 309 1.0E-06
sp|B8MF81|PEPA_TALSN Aspartic protease pep1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=pep1 PE=3 SV=1 3 308 3.0E-06
sp|O96009|NAPSA_HUMAN Napsin-A OS=Homo sapiens GN=NAPSA PE=1 SV=1 5 194 5.0E-06
sp|P83493|PAG6_SHEEP Pregnancy-associated glycoprotein 6 OS=Ovis aries PE=1 SV=2 5 116 7.0E-06
sp|O04057|ASPR_CUCPE Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1 15 114 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7934
LLAGFNITYLDRRNIQGDYFNDTVTVAGRAVQSQQLGLALRSVRGTGIMGLGFAANVAAGTPYPTVVDNMVRQGL
IDAPTFSLYLNDVDAKSGTILFGGIDSQKYVGNLVSLPLLPVAAGTGSSSPGADGSANNITTYSVRLEGVSVRSG
AGGSGYGLDGLGLGNMDARAILDSGSTITLLPDALVGRIHRALGVRAVDGVAAPLVDCAWRRARGAGTSFDFDFG
AGLVVRVPARYMVVDAFPPEVQQPLRDSDLGRYFRAWDGVCVFGIASAYDYGIASDRFALLGDTFLRSAYVVYDM
ANRQLAIAPANPNSDRSSIVAVRKNDKNLPNVTGVSPKESASTSLPCSGPAAIAALLLFLLLPALAAAL*
Coding >Hirsu2|7934
CTGCTCGCCGGCTTCAACATCACCTACCTCGACCGGCGCAACATCCAGGGCGACTACTTCAACGACACCGTCACC
GTCGCCGGCCGCGCCGTCCAGAGCCAGCAGCTGGGCCTGGCCCTGCGCTCCGTCCGCGGCACCGGCATCATGGGC
CTCGGCTTCGCCGCCAACGTCGCCGCCGGCACGCCCTACCCGACCGTCGTCGACAACATGGTGCGCCAGGGCCTC
ATCGACGCCCCGACCTTCAGCCTGTACCTGAACGACGTCGACGCCAAGTCCGGCACGATCCTCTTCGGCGGCATC
GACTCGCAAAAGTACGTCGGCAACCTCGTCAGCCTGCCGCTGCTGCCCGTCGCCGCCGGCACCGGCTCGTCGTCG
CCCGGCGCCGACGGCAGTGCCAACAACATCACGACCTACAGCGTCCGGCTCGAGGGCGTCAGCGTCCGGTCCGGC
GCCGGCGGCAGCGGGTACGGGCTCGACGGGCTCGGGCTCGGCAACATGGACGCGCGCGCCATCCTCGACTCGGGC
TCGACCATCACGCTGCTGCCGGACGCGCTCGTCGGCCGGATCCACCGCGCGCTCGGCGTCCGGGCCGTCGACGGC
GTCGCCGCCCCGCTCGTCGACTGCGCCTGGCGCCGGGCCCGCGGCGCCGGCACCAGCTTCGACTTCGACTTCGGC
GCCGGCCTCGTCGTCCGCGTCCCCGCCCGCTACATGGTCGTCGACGCCTTCCCGCCCGAGGTCCAGCAGCCGCTG
CGCGACAGCGACCTCGGCCGCTACTTTCGCGCCTGGGACGGCGTCTGCGTCTTCGGCATCGCCTCCGCCTACGAC
TACGGCATCGCCTCCGACCGCTTCGCCCTCCTCGGCGATACCTTCCTCCGCTCCGCCTACGTCGTCTACGACATG
GCCAACCGCCAGCTCGCCATCGCCCCGGCCAACCCCAACTCGGACCGCTCCAGCATCGTCGCCGTCCGCAAGAAC
GACAAGAACCTGCCCAACGTCACCGGCGTCTCCCCCAAGGAAAGCGCTTCGACCTCCCTCCCCTGCTCCGGCCCC
GCCGCCATCGCCGCCCTCCTCCTCTTCCTCCTCCTGCCCGCTCTCGCCGCCGCGCTGTAG
Transcript >Hirsu2|7934
CTGCTCGCCGGCTTCAACATCACCTACCTCGACCGGCGCAACATCCAGGGCGACTACTTCAACGACACCGTCACC
GTCGCCGGCCGCGCCGTCCAGAGCCAGCAGCTGGGCCTGGCCCTGCGCTCCGTCCGCGGCACCGGCATCATGGGC
CTCGGCTTCGCCGCCAACGTCGCCGCCGGCACGCCCTACCCGACCGTCGTCGACAACATGGTGCGCCAGGGCCTC
ATCGACGCCCCGACCTTCAGCCTGTACCTGAACGACGTCGACGCCAAGTCCGGCACGATCCTCTTCGGCGGCATC
GACTCGCAAAAGTACGTCGGCAACCTCGTCAGCCTGCCGCTGCTGCCCGTCGCCGCCGGCACCGGCTCGTCGTCG
CCCGGCGCCGACGGCAGTGCCAACAACATCACGACCTACAGCGTCCGGCTCGAGGGCGTCAGCGTCCGGTCCGGC
GCCGGCGGCAGCGGGTACGGGCTCGACGGGCTCGGGCTCGGCAACATGGACGCGCGCGCCATCCTCGACTCGGGC
TCGACCATCACGCTGCTGCCGGACGCGCTCGTCGGCCGGATCCACCGCGCGCTCGGCGTCCGGGCCGTCGACGGC
GTCGCCGCCCCGCTCGTCGACTGCGCCTGGCGCCGGGCCCGCGGCGCCGGCACCAGCTTCGACTTCGACTTCGGC
GCCGGCCTCGTCGTCCGCGTCCCCGCCCGCTACATGGTCGTCGACGCCTTCCCGCCCGAGGTCCAGCAGCCGCTG
CGCGACAGCGACCTCGGCCGCTACTTTCGCGCCTGGGACGGCGTCTGCGTCTTCGGCATCGCCTCCGCCTACGAC
TACGGCATCGCCTCCGACCGCTTCGCCCTCCTCGGCGATACCTTCCTCCGCTCCGCCTACGTCGTCTACGACATG
GCCAACCGCCAGCTCGCCATCGCCCCGGCCAACCCCAACTCGGACCGCTCCAGCATCGTCGCCGTCCGCAAGAAC
GACAAGAACCTGCCCAACGTCACCGGCGTCTCCCCCAAGGAAAGCGCTTCGACCTCCCTCCCCTGCTCCGGCCCC
GCCGCCATCGCCGCCCTCCTCCTCTTCCTCCTCCTGCCCGCTCTCGCCGCCGCGCTGTAG
Gene >Hirsu2|7934
CTGCTCGTCTCTCGCTCATGGGCCGACCCTTGATCCAGTCAACCCGCGCTCGAGCACGAGCTTCCGCCTCGTCGA
CCAGGCCGGCTTCAACATCACCTACCTCGACCGGCGCAACATCCAGGGCGACTACTTCAACGACACCGTCACCGT
CGCCGGCCGCGCCGTCCAGAGCCAGCAGCTGGGCCTGGCCCTGCGCTCCGTCCGCGGCACCGGCATCATGGGCCT
CGGCTTCGCCGCCAACGTCGCCGCCGGCACGCCCTACCCGACCGTCGTCGACAACATGGTGCGCCAGGGCCTCAT
CGACGCCCCGACCTTCAGCCTGTACCTGGTGCGTCTGATCTGCCCGCTCGATCCGTTCCGGCCGCTGACTTTTGG
GCTGTGCAGAACGACGTCGACGCCAAGTCCGGCACGATCCTCTTCGGCGGCATCGACTCGCAAAAGTACGTCGGC
AACCTCGTCAGCCTGCCGCTGCTGCCCGTCGCCGCCGGCACCGGCTCGTCGTCGCCCGGCGCCGACGGCAGTGCC
AACAACATCACGACCTACAGCGTCCGGCTCGAGGGCGTCAGCGTCCGGTCCGGCGCCGGCGGCAGCGGGTACGGG
CTCGACGGGCTCGGGCTCGGCAACATGGACGCGCGCGCCATCCTCGACTCGGGCTCGACCATCACGCTGCTGCCG
GACGCGCTCGTCGGCCGGATCCACCGCGCGCTCGGCGTCCGGGCCGTCGACGGCGTCGCCGCCCCGCTCGTCGAC
TGCGCCTGGCGCCGGGCCCGCGGCGCCGGCACCAGCTTCGACTTCGACTTCGGCGCCGGCCTCGTCGTCCGCGTC
CCCGCCCGCTACATGGTCGTCGACGCCTTCCCGCCCGAGGTCCAGCAGCCGCTGCGCGACAGCGACCTCGGCCGC
TACTTTCGCGCCTGGGACGGCGTCTGCGTCTTCGGCATCGCCTCCGCCTACGACTACGGCATCGCCTCCGACCGC
TTCGCCCTCCTCGGCGATACCTTCCTCCGCTCCGCCTACGTCGTCTACGACATGGCCAACCGCCAGCTCGCCATC
GCCCCGGCCAACCCCAACTCGGACCGCTCCAGCATCGTCGCCGTCCGCAAGAACGACAAGAACCTGCCCAACGTC
ACCGGCGTCTCCCGTACGTCTCTCTCACGCTCTCTCTGTCTCTCTCACTCTCTCACGTATTATATATACGGTACA
ATAAGCTGACATATTCCCTCCTCCCAGCCAAGGAAAGCGCTTCGACCTCCCTCCCCTGCTCCGGCCCCGCCGCCA
TCGCCGCCCTCCTCCTCTTCCTCCTCCTGCCCGCTCTCGCCGCCGCGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail