Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7933
Gene name
LocationContig_49:48156..48852
Strand+
Gene length (bp)696
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 1.2E-31 3 213

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 12 213 2.0E-31
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 12 213 3.0E-31
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 12 217 2.0E-25
sp|P20013|LIGC_TRAVE Ligninase C OS=Trametes versicolor PE=1 SV=2 12 219 2.0E-24
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 12 218 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 12 213 2.0E-31
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 12 213 3.0E-31
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 12 217 2.0E-25
sp|P20013|LIGC_TRAVE Ligninase C OS=Trametes versicolor PE=1 SV=2 12 219 2.0E-24
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 12 218 2.0E-23
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 12 213 2.0E-23
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 12 213 3.0E-23
sp|P78733|PEM3_PHACH Manganese peroxidase H3 OS=Phanerochaete chrysosporium PE=1 SV=2 12 226 4.0E-23
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 12 218 9.0E-23
sp|P20010|LIG_PHLRA Ligninase-3 OS=Phlebia radiata PE=3 SV=1 9 212 2.0E-22
sp|P50622|LIG6_PHACH Ligninase LG6 OS=Phanerochaete chrysosporium GN=GLG6 PE=2 SV=1 12 218 2.0E-20
sp|P49012|LIG2_PHACH Ligninase LG2 OS=Phanerochaete chrysosporium GN=GLG2 PE=1 SV=1 12 218 2.0E-18
sp|Q9UVP6|VPS1_PLEER Versatile peroxidase VPS1 OS=Pleurotus eryngii GN=vps1 PE=1 SV=1 12 213 2.0E-18
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 9 219 3.0E-18
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 16 202 5.0E-18
sp|P06181|LIG8_PHACH Ligninase H8 OS=Phanerochaete chrysosporium GN=LPOA PE=1 SV=1 12 218 7.0E-17
sp|P11542|LIG4_PHACH Ligninase H2 OS=Phanerochaete chrysosporium GN=GLG4 PE=1 SV=2 12 219 9.0E-17
sp|P21764|LIG3_PHACH Ligninase LG3 OS=Phanerochaete chrysosporium GN=GLG3 PE=2 SV=1 12 218 9.0E-17
sp|P28313|PER_ARTRA Peroxidase OS=Arthromyces ramosus PE=1 SV=3 12 216 1.0E-16
sp|P28314|PER_COPCI Peroxidase OS=Coprinopsis cinerea GN=CIP1 PE=1 SV=2 12 216 2.0E-16
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 9 203 3.0E-16
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 20 203 3.0E-16
sp|A8NK72|PER_COPC7 Peroxidase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CIP1 PE=3 SV=1 12 216 5.0E-16
sp|P31838|LIGB_PHACH Ligninase B OS=Phanerochaete chrysosporium GN=LIPB PE=3 SV=1 12 218 1.0E-15
sp|P31837|LIGA_PHACH Ligninase A OS=Phanerochaete chrysosporium GN=LIPA PE=3 SV=1 12 218 1.0E-15
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 2 203 2.0E-15
sp|C0IW58|LNP_TAICA Low-redox potential peroxidase OS=Taiwanofungus camphoratus GN=LnP PE=1 SV=1 53 213 2.0E-15
sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 2 203 5.0E-15
sp|P0C0L1|APX6_ORYSJ Probable L-ascorbate peroxidase 6, chloroplastic OS=Oryza sativa subsp. japonica GN=APX6 PE=2 SV=1 20 163 3.0E-12
sp|Q69SV0|APX8_ORYSJ Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2 20 163 3.0E-11
sp|Q42593|APXT_ARATH L-ascorbate peroxidase T, chloroplastic OS=Arabidopsis thaliana GN=APXT PE=2 SV=2 20 163 5.0E-11
sp|Q42592|APXS_ARATH L-ascorbate peroxidase S, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=APXS PE=1 SV=2 20 163 5.0E-11
sp|Q9FE01|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1 20 203 1.0E-10
sp|Q05431|APX1_ARATH L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2 20 203 1.0E-10
sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 20 203 1.0E-10
sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 20 203 2.0E-10
sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 16 203 6.0E-10
sp|Q9LHA7|PER31_ARATH Peroxidase 31 OS=Arabidopsis thaliana GN=PER31 PE=2 SV=1 16 206 6.0E-10
sp|Q4WLG9|CCPR2_ASPFU Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G13570 PE=3 SV=1 20 153 1.0E-09
sp|P0C0L0|APX5_ORYSJ Probable L-ascorbate peroxidase 5, chloroplastic OS=Oryza sativa subsp. japonica GN=APX5 PE=2 SV=1 20 163 2.0E-09
sp|Q6BKY9|CCPR_DEBHA Cytochrome c peroxidase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCP1 PE=3 SV=1 21 153 3.0E-09
sp|Q9FL16|PER63_ARATH Peroxidase 63 OS=Arabidopsis thaliana GN=PER63 PE=2 SV=1 16 206 4.0E-09
sp|Q5AEN1|CCPR_CANAL Cytochrome c peroxidase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCP1 PE=3 SV=1 20 153 9.0E-09
sp|P48534|APX1_PEA L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2 20 202 1.0E-08
sp|Q96511|PER69_ARATH Peroxidase 69 OS=Arabidopsis thaliana GN=PER69 PE=1 SV=1 16 216 1.0E-08
sp|Q96519|PER11_ARATH Peroxidase 11 OS=Arabidopsis thaliana GN=PER11 PE=1 SV=1 16 153 2.0E-08
sp|Q9SZB9|PER47_ARATH Peroxidase 47 OS=Arabidopsis thaliana GN=PER47 PE=2 SV=2 15 218 4.0E-08
sp|Q9SD46|PER36_ARATH Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=2 SV=2 2 157 6.0E-08
sp|Q0D3N0|PER2_ORYSJ Peroxidase 2 OS=Oryza sativa subsp. japonica GN=PRX112 PE=2 SV=1 20 155 8.0E-08
sp|A2YPX3|PER2_ORYSI Peroxidase 2 OS=Oryza sativa subsp. indica GN=PRX112 PE=3 SV=2 20 155 9.0E-08
sp|Q05855|PER1_WHEAT Peroxidase OS=Triticum aestivum PE=2 SV=1 20 155 1.0E-07
sp|Q6C7U1|CCPR3_YARLI Putative heme-binding peroxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D25366g PE=3 SV=1 15 163 2.0E-07
sp|P00431|CCPR_YEAST Cytochrome c peroxidase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCP1 PE=1 SV=2 20 204 2.0E-07
sp|Q4HWQ2|CCPR2_GIBZE Putative heme-binding peroxidase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_10606 PE=3 SV=1 5 153 2.0E-07
sp|Q9SJZ2|PER17_ARATH Peroxidase 17 OS=Arabidopsis thaliana GN=PER17 PE=2 SV=1 1 155 2.0E-07
sp|P11965|PERX_TOBAC Lignin-forming anionic peroxidase OS=Nicotiana tabacum PE=2 SV=1 20 164 2.0E-07
sp|Q6CW24|CCPR_KLULA Cytochrome c peroxidase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCP1 PE=3 SV=1 20 185 3.0E-07
sp|Q4PBY6|CCPR_USTMA Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCP1 PE=3 SV=1 3 206 3.0E-07
sp|Q96512|PER9_ARATH Peroxidase 9 OS=Arabidopsis thaliana GN=PER9 PE=1 SV=1 15 155 3.0E-07
sp|Q5B1Z0|CCPR2_EMENI Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5440 PE=3 SV=1 1 153 3.0E-07
sp|Q6FMG7|CCPR_CANGA Cytochrome c peroxidase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0K08184g PE=3 SV=1 20 153 4.0E-07
sp|O23237|PER49_ARATH Peroxidase 49 OS=Arabidopsis thaliana GN=PER49 PE=2 SV=2 15 155 5.0E-07
sp|Q96518|PER16_ARATH Peroxidase 16 OS=Arabidopsis thaliana GN=PER16 PE=1 SV=2 16 151 6.0E-07
sp|A5H453|PER42_MAIZE Peroxidase 42 OS=Zea mays GN=PER42 PE=2 SV=1 15 155 6.0E-07
sp|Q7SDV9|CCPR_NEUCR Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccp-1 PE=3 SV=1 20 185 7.0E-07
sp|P00434|PERP7_BRARR Peroxidase P7 OS=Brassica rapa subsp. rapa PE=1 SV=3 20 158 9.0E-07
sp|A4QVH4|CCPR_MAGO7 Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CCP1 PE=3 SV=1 20 163 1.0E-06
sp|Q9FLC0|PER52_ARATH Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=2 SV=1 20 155 2.0E-06
sp|A4R606|CCPR2_MAGO7 Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_10368 PE=3 SV=1 20 153 2.0E-06
sp|O48677|PER6_ARATH Peroxidase 6 OS=Arabidopsis thaliana GN=PER6 PE=2 SV=1 16 151 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006979 response to oxidative stress Yes
GO:0020037 heme binding Yes
GO:0004601 peroxidase activity Yes
GO:0006950 response to stress No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0016209 antioxidant activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0050896 response to stimulus No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.4219 0.1423 0.7943 0.078 0.2566 0.1391 0.1152 0.213 0.0991 0.0215

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA2 2.0E-53 7 217

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup72
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7755
Ophiocordyceps australis map64 (Brazil) OphauB2|5788
Ophiocordyceps camponoti-floridani Ophcf2|03380
Ophiocordyceps camponoti-floridani Ophcf2|05952
Ophiocordyceps camponoti-floridani Ophcf2|06949
Ophiocordyceps camponoti-rufipedis Ophun1|2842
Ophiocordyceps camponoti-rufipedis Ophun1|490
Ophiocordyceps camponoti-rufipedis Ophun1|576
Ophiocordyceps kimflemingae Ophio5|1136
Ophiocordyceps kimflemingae Ophio5|3516
Ophiocordyceps kimflemingae Ophio5|4077
Ophiocordyceps kimflemingae Ophio5|6981
Ophiocordyceps subramaniannii Hirsu2|2648
Ophiocordyceps subramaniannii Hirsu2|7177
Ophiocordyceps subramaniannii Hirsu2|7933 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9306

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7933
MAQAMVEPNRTCNDVARAAIRLGFHDAAAWEMGMRSGGADGSVVLARECETRPENSGLQDVCGRMRTWFDKYKRN
NVSMADLIQMGANVGAVVCPLGPRVRSFVGRKDSKTAAPEDLIPGPDQSAEQLIAVFARKTFTPQGIVALVGSHS
VARQRFIQPNRSGEALDSTVGVWDTNFYGEVLDAKAPTNIFKLQSDVSLSTDPRTKGAWNSFVGAKAQESAIEVS
MCWAAT*
Coding >Hirsu2|7933
ATGGCGCAGGCCATGGTCGAGCCGAACCGCACCTGCAACGACGTGGCCCGGGCCGCCATTCGGCTCGGCTTTCAC
GACGCGGCCGCCTGGGAGATGGGCATGCGGTCCGGAGGTGCCGACGGCTCCGTCGTGCTGGCGCGAGAGTGCGAG
ACGCGCCCCGAGAACAGCGGGCTGCAGGACGTCTGCGGGCGCATGCGGACCTGGTTCGACAAGTATAAGCGGAAC
AACGTCTCCATGGCCGATCTGATCCAGATGGGCGCCAATGTTGGCGCCGTCGTCTGTCCTCTCGGGCCTCGGGTC
CGCTCCTTCGTCGGCCGTAAGGATAGTAAGACGGCGGCCCCCGAGGATCTGATTCCGGGCCCGGACCAGAGCGCC
GAGCAGCTTATCGCCGTTTTCGCCAGGAAGACCTTCACCCCCCAGGGCATAGTCGCCCTCGTCGGCTCCCACTCG
GTTGCCCGGCAGCGCTTCATCCAGCCCAACCGAAGCGGAGAGGCGCTTGACTCGACCGTAGGCGTCTGGGACACC
AACTTCTACGGCGAGGTGCTTGATGCTAAGGCCCCGACGAACATCTTCAAGCTGCAAAGCGACGTGAGCCTCAGT
ACTGATCCACGCACCAAGGGCGCCTGGAATTCTTTTGTTGGTGCGAAAGCACAGGAGTCGGCAATCGAGGTGAGC
ATGTGTTGGGCTGCAACTTGA
Transcript >Hirsu2|7933
ATGGCGCAGGCCATGGTCGAGCCGAACCGCACCTGCAACGACGTGGCCCGGGCCGCCATTCGGCTCGGCTTTCAC
GACGCGGCCGCCTGGGAGATGGGCATGCGGTCCGGAGGTGCCGACGGCTCCGTCGTGCTGGCGCGAGAGTGCGAG
ACGCGCCCCGAGAACAGCGGGCTGCAGGACGTCTGCGGGCGCATGCGGACCTGGTTCGACAAGTATAAGCGGAAC
AACGTCTCCATGGCCGATCTGATCCAGATGGGCGCCAATGTTGGCGCCGTCGTCTGTCCTCTCGGGCCTCGGGTC
CGCTCCTTCGTCGGCCGTAAGGATAGTAAGACGGCGGCCCCCGAGGATCTGATTCCGGGCCCGGACCAGAGCGCC
GAGCAGCTTATCGCCGTTTTCGCCAGGAAGACCTTCACCCCCCAGGGCATAGTCGCCCTCGTCGGCTCCCACTCG
GTTGCCCGGCAGCGCTTCATCCAGCCCAACCGAAGCGGAGAGGCGCTTGACTCGACCGTAGGCGTCTGGGACACC
AACTTCTACGGCGAGGTGCTTGATGCTAAGGCCCCGACGAACATCTTCAAGCTGCAAAGCGACGTGAGCCTCAGT
ACTGATCCACGCACCAAGGGCGCCTGGAATTCTTTTGTTGGTGCGAAAGCACAGGAGTCGGCAATCGAGGTGAGC
ATGTGTTGGGCTGCAACTTGA
Gene >Hirsu2|7933
ATGGCGCAGGCCATGGTCGAGCCGAACCGCACCTGCAACGACGTGGCCCGGGCCGCCATTCGGCTCGGCTTTCAC
GACGCGGCCGCCTGGGAGATGGGCATGCGGTCCGGAGGTGCCGACGGCTCCGTCGTGCTGGCGCGAGAGTGCGAG
ACGCGCCCCGAGAACAGCGGGCTGCAGGACGTCTGCGGGCGCATGCGGACCTGGTTCGACAAGTATAAGCGGAAC
AACGTCTCCATGGCCGATCTGATCCAGATGGGCGCCAATGTTGGCGCCGTCGTCTGTCCTCTCGGGCCTCGGGTC
CGCTCCTTCGTCGGCCGTAAGGATAGTAAGACGGCGGCCCCCGAGGATCTGATTCCGGGCCCGGACCAGAGCGCC
GAGCAGCTTATCGCCGTTTTCGCCAGGAAGACCTTCACCCCCCAGGGCATAGTCGCCCTCGTCGGCTCCCACTCG
GTTGCCCGGCAGCGCTTCATCCAGCCCAACCGAAGCGGAGAGGCGCTTGACTCGACCGTAGGCGTCTGGGACACC
AACTTCTACGGCGAGGTGCTTGATGCTAAGGCCCCGACGAACATCTTCAAGCTGCAAAGCGACGTGAGCCTCAGT
ACTGATCCACGCACCAAGGGCGCCTGGAATTCTTTTGTTGGTGCGAAAGCACAGGAGTCGGCAATCGAGGTGAGC
ATGTGTTGGGCTGCAACTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail