Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7926
Gene name
LocationContig_49:22153..22651
Strand+
Gene length (bp)498
Transcript length (bp)498
Coding sequence length (bp)498
Protein length (aa) 166

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 3.1E-22 2 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 1 147 2.0E-35
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 1 147 6.0E-35
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 2 138 2.0E-21
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 2 138 2.0E-21
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 2 139 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 1 147 2.0E-35
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 1 147 6.0E-35
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 2 138 2.0E-21
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 2 138 2.0E-21
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 2 139 3.0E-18
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 2 146 8.0E-18
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 2 139 2.0E-17
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 2 139 1.0E-16
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 2 140 2.0E-14
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 2 138 2.0E-12
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 2 161 5.0E-12
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 2 152 1.0E-11
sp|D5AP78|CRTF_RHOCB Demethylspheroidene O-methyltransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=crtF PE=1 SV=1 2 163 1.0E-11
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 2 161 7.0E-11
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 2 139 2.0E-10
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 2 146 3.0E-10
sp|Q8T638|DMTA_DICDI Des-methyl DIF-1 methyltransferase A OS=Dictyostelium discoideum GN=dmtA PE=1 SV=1 2 164 4.0E-10
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 2 157 6.0E-10
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 2 140 1.0E-09
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 2 139 1.0E-09
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 2 139 3.0E-09
sp|B6VJS4|ROMT_VITVI Trans-resveratrol di-O-methyltransferase OS=Vitis vinifera GN=ROMT PE=1 SV=2 2 138 3.0E-09
sp|D3KU66|ASMT_MOUSE Acetylserotonin O-methyltransferase OS=Mus musculus GN=Asmt PE=2 SV=1 46 140 9.0E-09
sp|D3KU67|ASMT_MUSMM Acetylserotonin O-methyltransferase OS=Mus musculus molossinus GN=Asmt PE=2 SV=1 46 140 1.0E-08
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 2 137 2.0E-08
sp|P46597|ASMT_HUMAN Acetylserotonin O-methyltransferase OS=Homo sapiens GN=ASMT PE=1 SV=1 1 160 6.0E-08
sp|P10950|ASMT_BOVIN Acetylserotonin O-methyltransferase OS=Bos taurus GN=ASMT PE=1 SV=2 1 138 8.0E-08
sp|Q42653|OMT2_CHRAE Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1 2 137 9.0E-08
sp|Q8H9A8|COOMT_COPJA Columbamine O-methyltransferase OS=Coptis japonica PE=1 SV=1 2 140 9.0E-08
sp|P59049|OMT1_CHRAE Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1 2 137 1.0E-07
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 2 145 1.0E-07
sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 2 145 1.0E-07
sp|Q8HZJ0|ASMT_MACMU Acetylserotonin O-methyltransferase OS=Macaca mulatta GN=ASMT PE=2 SV=1 1 160 2.0E-07
sp|Q54B60|OMT11_DICDI Probable inactive O-methyltransferase 11 OS=Dictyostelium discoideum GN=omt11 PE=3 SV=1 2 146 2.0E-07
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 4 139 3.0E-07
sp|Q9XGW0|COMT1_OCIBA Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1 2 145 4.0E-07
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 2 159 4.0E-07
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 2 138 6.0E-07
sp|Q93WU3|CVMT1_OCIBA Chavicol O-methyltransferase OS=Ocimum basilicum GN=CVOMT1 PE=1 SV=1 2 161 1.0E-06
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 2 145 1.0E-06
sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1 2 163 1.0E-06
sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 2 137 1.0E-06
sp|Q9XGV9|COMT2_OCIBA Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1 2 145 1.0E-06
sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 2 137 2.0E-06
sp|Q9SWC2|COMT1_EUCGL Caffeic acid 3-O-methyltransferase (Fragment) OS=Eucalyptus globulus GN=COMT1 PE=3 SV=1 2 130 3.0E-06
sp|Q6VMW0|Q8OMT_MENPI 8-hydroxyquercetin 8-O-methyltransferase OS=Mentha piperita GN=OMT2 PE=1 SV=1 62 138 4.0E-06
sp|Q8LL87|COMT1_COFCA Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1 2 137 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6549 0.4852 0.0439 0.0746 0.0611 0.025 0.2045 0.5496 0.3801 0.0074

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7926
MLVDVGGGYGHDLEEFHGKYPDAPGRLVLQDLARVLDKVHRRSAAIQYMEYDFLTEQPVWGARAYYLHQILHDYP
DERCADIVERVKGAMKPGYSKLLINEHIIPDVGASWEATYLDIYMMTLFSARERTENEWRNLLEKRCGMKILAFW
NPGSGVEGIIECELA*
Coding >Hirsu2|7926
ATGCTGGTCGATGTCGGCGGAGGCTACGGTCACGATTTGGAAGAATTCCACGGTAAGTACCCGGACGCACCCGGC
CGCCTCGTGTTGCAGGACCTCGCCCGAGTACTAGACAAGGTCCATCGTCGGAGCGCAGCGATCCAGTACATGGAG
TATGATTTCCTGACGGAGCAACCCGTTTGGGGAGCCCGGGCGTACTATCTGCACCAGATCCTACACGACTATCCG
GACGAACGGTGCGCAGACATCGTCGAGAGGGTCAAGGGCGCCATGAAGCCGGGGTACAGCAAATTGCTCATCAAC
GAGCACATCATTCCCGACGTGGGGGCGAGCTGGGAGGCGACATATCTAGATATATACATGATGACCCTGTTTAGT
GCGCGTGAGAGGACGGAGAACGAATGGCGCAATCTGCTTGAGAAGCGCTGCGGAATGAAGATTTTGGCCTTTTGG
AACCCAGGCAGTGGTGTTGAGGGTATTATTGAATGCGAGCTCGCTTGA
Transcript >Hirsu2|7926
ATGCTGGTCGATGTCGGCGGAGGCTACGGTCACGATTTGGAAGAATTCCACGGTAAGTACCCGGACGCACCCGGC
CGCCTCGTGTTGCAGGACCTCGCCCGAGTACTAGACAAGGTCCATCGTCGGAGCGCAGCGATCCAGTACATGGAG
TATGATTTCCTGACGGAGCAACCCGTTTGGGGAGCCCGGGCGTACTATCTGCACCAGATCCTACACGACTATCCG
GACGAACGGTGCGCAGACATCGTCGAGAGGGTCAAGGGCGCCATGAAGCCGGGGTACAGCAAATTGCTCATCAAC
GAGCACATCATTCCCGACGTGGGGGCGAGCTGGGAGGCGACATATCTAGATATATACATGATGACCCTGTTTAGT
GCGCGTGAGAGGACGGAGAACGAATGGCGCAATCTGCTTGAGAAGCGCTGCGGAATGAAGATTTTGGCCTTTTGG
AACCCAGGCAGTGGTGTTGAGGGTATTATTGAATGCGAGCTCGCTTGA
Gene >Hirsu2|7926
ATGCTGGTCGATGTCGGCGGAGGCTACGGTCACGATTTGGAAGAATTCCACGGTAAGTACCCGGACGCACCCGGC
CGCCTCGTGTTGCAGGACCTCGCCCGAGTACTAGACAAGGTCCATCGTCGGAGCGCAGCGATCCAGTACATGGAG
TATGATTTCCTGACGGAGCAACCCGTTTGGGGAGCCCGGGCGTACTATCTGCACCAGATCCTACACGACTATCCG
GACGAACGGTGCGCAGACATCGTCGAGAGGGTCAAGGGCGCCATGAAGCCGGGGTACAGCAAATTGCTCATCAAC
GAGCACATCATTCCCGACGTGGGGGCGAGCTGGGAGGCGACATATCTAGATATATACATGATGACCCTGTTTAGT
GCGCGTGAGAGGACGGAGAACGAATGGCGCAATCTGCTTGAGAAGCGCTGCGGAATGAAGATTTTGGCCTTTTGG
AACCCAGGCAGTGGTGTTGAGGGTATTATTGAATGCGAGCTCGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail