Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|792
Gene name
LocationContig_1164:590..1583
Strand-
Gene length (bp)993
Transcript length (bp)993
Coding sequence length (bp)993
Protein length (aa) 331

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02338 OTU OTU-like cysteine protease 2.9E-17 197 321

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38747|OTU2_YEAST OTU domain-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OTU2 PE=1 SV=1 9 324 2.0E-45
sp|Q9UUK3|OTU2_SCHPO Ubiquitin thioesterase otu2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=otu2 PE=3 SV=1 8 324 1.0E-30
sp|Q7ZV00|OTU6B_DANRE OTU domain-containing protein 6B OS=Danio rerio GN=otud6b PE=2 SV=1 12 324 2.0E-29
sp|Q5ZIP6|OTU6B_CHICK OTU domain-containing protein 6B OS=Gallus gallus GN=OTUD6B PE=2 SV=1 11 328 1.0E-24
sp|Q8N6M0|OTU6B_HUMAN OTU domain-containing protein 6B OS=Homo sapiens GN=OTUD6B PE=1 SV=1 17 324 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38747|OTU2_YEAST OTU domain-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OTU2 PE=1 SV=1 9 324 2.0E-45
sp|Q9UUK3|OTU2_SCHPO Ubiquitin thioesterase otu2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=otu2 PE=3 SV=1 8 324 1.0E-30
sp|Q7ZV00|OTU6B_DANRE OTU domain-containing protein 6B OS=Danio rerio GN=otud6b PE=2 SV=1 12 324 2.0E-29
sp|Q5ZIP6|OTU6B_CHICK OTU domain-containing protein 6B OS=Gallus gallus GN=OTUD6B PE=2 SV=1 11 328 1.0E-24
sp|Q8N6M0|OTU6B_HUMAN OTU domain-containing protein 6B OS=Homo sapiens GN=OTUD6B PE=1 SV=1 17 324 2.0E-23
sp|Q5M8L0|OTU6B_XENTR OTU domain-containing protein 6B OS=Xenopus tropicalis GN=otud6b PE=2 SV=1 17 324 4.0E-23
sp|Q6GM06|OTU6B_XENLA OTU domain-containing protein 6B OS=Xenopus laevis GN=otud6b PE=2 SV=1 145 324 9.0E-23
sp|Q8K2H2|OTU6B_MOUSE OTU domain-containing protein 6B OS=Mus musculus GN=Otud6b PE=1 SV=1 169 330 8.0E-22
sp|Q7L8S5|OTU6A_HUMAN OTU domain-containing protein 6A OS=Homo sapiens GN=OTUD6A PE=1 SV=1 193 324 3.0E-16
sp|Q6IE21|OTU6A_MOUSE OTU domain-containing protein 6A OS=Mus musculus GN=Otud6a PE=1 SV=1 9 325 1.0E-14
sp|Q640H3|OTU5B_XENLA OTU domain-containing protein 5-B OS=Xenopus laevis GN=otud5-b PE=2 SV=1 164 324 4.0E-09
sp|Q7ZX21|OTU5A_XENLA OTU domain-containing protein 5-A OS=Xenopus laevis GN=otud5-a PE=2 SV=1 164 324 6.0E-09
sp|Q08BW0|OTU5A_DANRE OTU domain-containing protein 5-A OS=Danio rerio GN=otud5a PE=2 SV=1 190 324 2.0E-08
sp|Q6GL44|OTUD5_XENTR OTU domain-containing protein 5 OS=Xenopus tropicalis GN=otud5 PE=2 SV=1 132 324 3.0E-08
sp|Q3U2S4|OTUD5_MOUSE OTU domain-containing protein 5 OS=Mus musculus GN=Otud5 PE=1 SV=2 155 324 5.0E-08
sp|Q2YDU3|OTUD5_RAT OTU domain-containing protein 5 OS=Rattus norvegicus GN=Otud5 PE=1 SV=2 155 324 6.0E-08
sp|Q96G74|OTUD5_HUMAN OTU domain-containing protein 5 OS=Homo sapiens GN=OTUD5 PE=1 SV=1 155 287 3.0E-07
sp|B1AZ99|OTUD3_MOUSE OTU domain-containing protein 3 OS=Mus musculus GN=Otud3 PE=3 SV=1 133 326 4.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.794 0.6472 0.0193 0.065 0.0725 0.0035 0.1842 0.0958 0.1418 0.0067

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup981
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6143
Ophiocordyceps australis map64 (Brazil) OphauB2|5310
Ophiocordyceps camponoti-floridani Ophcf2|02053
Ophiocordyceps camponoti-floridani Ophcf2|07437
Ophiocordyceps camponoti-rufipedis Ophun1|7015
Ophiocordyceps kimflemingae Ophio5|7398
Ophiocordyceps subramaniannii Hirsu2|792 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|792
METELLETESLEQVQARHRKELKELQGRITNKKKNATKKTRKGVNDECAEMERRLREKQAAEMADLSGADQTRPG
HEDDEGGGGGDAPGGETRANGFVRLMEREVEGRLERAAEKLHLTDHHHHHHHHHDDGPAAGGDRKKRNRHKDRLA
RRAAEQEAAARQAEVEAASMTDHRARESAYMKKMFQTYDLVEKEVEPDGHCLFSAMADQLKQHGIPLGPDRPPEP
AYKVVRRVAAGFMLDNADDFAPFLDEDLDAYAARVRDTAEWGGQLELMALARRYGAEIRVIQDGRTERIGEDEGR
ATGKTLWLAYYRHGYGLGEHYNSLRKKTGS*
Coding >Hirsu2|792
ATGGAGACGGAGCTGTTGGAGACGGAGTCGCTGGAGCAGGTGCAGGCGCGGCACCGCAAAGAGCTCAAGGAGCTA
CAGGGCCGCATCACGAACAAGAAGAAGAACGCGACGAAGAAGACGCGCAAGGGCGTCAACGACGAGTGCGCCGAG
ATGGAGCGGCGGCTGCGGGAGAAGCAGGCGGCCGAGATGGCGGACCTGAGCGGCGCGGACCAGACGCGCCCCGGG
CACGAAGACGACGAGGGCGGTGGCGGCGGGGACGCACCCGGCGGAGAGACGCGGGCCAACGGCTTCGTCCGGCTG
ATGGAGCGCGAGGTGGAGGGCCGGCTGGAGAGGGCGGCCGAGAAACTACACCTGACGGACCACCACCACCACCAC
CACCACCACCATGACGACGGGCCGGCCGCGGGCGGCGACCGGAAGAAGCGGAACCGGCACAAGGACCGGCTGGCG
CGGCGGGCGGCCGAGCAGGAGGCGGCGGCGCGGCAGGCCGAGGTGGAGGCGGCGTCGATGACGGACCACCGGGCG
CGCGAGAGCGCCTACATGAAGAAGATGTTCCAGACGTACGACCTGGTGGAGAAGGAGGTCGAGCCGGACGGCCAC
TGCCTCTTCTCCGCCATGGCCGACCAGCTCAAGCAGCACGGCATCCCGCTCGGGCCCGACCGGCCGCCGGAGCCG
GCCTACAAGGTGGTGCGGCGCGTGGCGGCCGGCTTCATGCTCGACAACGCCGACGACTTCGCCCCCTTCCTCGAC
GAGGACCTCGACGCCTACGCCGCCCGCGTGCGCGACACGGCCGAGTGGGGCGGCCAGCTCGAGCTCATGGCCCTC
GCCCGCCGCTACGGCGCCGAGATCCGCGTCATCCAGGACGGCCGCACCGAGCGCATCGGCGAGGACGAGGGCCGC
GCCACCGGCAAGACGCTGTGGCTGGCCTACTACCGGCACGGCTACGGCCTGGGCGAGCACTACAACTCGCTGCGG
AAGAAGACGGGGTCCTAA
Transcript >Hirsu2|792
ATGGAGACGGAGCTGTTGGAGACGGAGTCGCTGGAGCAGGTGCAGGCGCGGCACCGCAAAGAGCTCAAGGAGCTA
CAGGGCCGCATCACGAACAAGAAGAAGAACGCGACGAAGAAGACGCGCAAGGGCGTCAACGACGAGTGCGCCGAG
ATGGAGCGGCGGCTGCGGGAGAAGCAGGCGGCCGAGATGGCGGACCTGAGCGGCGCGGACCAGACGCGCCCCGGG
CACGAAGACGACGAGGGCGGTGGCGGCGGGGACGCACCCGGCGGAGAGACGCGGGCCAACGGCTTCGTCCGGCTG
ATGGAGCGCGAGGTGGAGGGCCGGCTGGAGAGGGCGGCCGAGAAACTACACCTGACGGACCACCACCACCACCAC
CACCACCACCATGACGACGGGCCGGCCGCGGGCGGCGACCGGAAGAAGCGGAACCGGCACAAGGACCGGCTGGCG
CGGCGGGCGGCCGAGCAGGAGGCGGCGGCGCGGCAGGCCGAGGTGGAGGCGGCGTCGATGACGGACCACCGGGCG
CGCGAGAGCGCCTACATGAAGAAGATGTTCCAGACGTACGACCTGGTGGAGAAGGAGGTCGAGCCGGACGGCCAC
TGCCTCTTCTCCGCCATGGCCGACCAGCTCAAGCAGCACGGCATCCCGCTCGGGCCCGACCGGCCGCCGGAGCCG
GCCTACAAGGTGGTGCGGCGCGTGGCGGCCGGCTTCATGCTCGACAACGCCGACGACTTCGCCCCCTTCCTCGAC
GAGGACCTCGACGCCTACGCCGCCCGCGTGCGCGACACGGCCGAGTGGGGCGGCCAGCTCGAGCTCATGGCCCTC
GCCCGCCGCTACGGCGCCGAGATCCGCGTCATCCAGGACGGCCGCACCGAGCGCATCGGCGAGGACGAGGGCCGC
GCCACCGGCAAGACGCTGTGGCTGGCCTACTACCGGCACGGCTACGGCCTGGGCGAGCACTACAACTCGCTGCGG
AAGAAGACGGGGTCCTAA
Gene >Hirsu2|792
ATGGAGACGGAGCTGTTGGAGACGGAGTCGCTGGAGCAGGTGCAGGCGCGGCACCGCAAAGAGCTCAAGGAGCTA
CAGGGCCGCATCACGAACAAGAAGAAGAACGCGACGAAGAAGACGCGCAAGGGCGTCAACGACGAGTGCGCCGAG
ATGGAGCGGCGGCTGCGGGAGAAGCAGGCGGCCGAGATGGCGGACCTGAGCGGCGCGGACCAGACGCGCCCCGGG
CACGAAGACGACGAGGGCGGTGGCGGCGGGGACGCACCCGGCGGAGAGACGCGGGCCAACGGCTTCGTCCGGCTG
ATGGAGCGCGAGGTGGAGGGCCGGCTGGAGAGGGCGGCCGAGAAACTACACCTGACGGACCACCACCACCACCAC
CACCACCACCATGACGACGGGCCGGCCGCGGGCGGCGACCGGAAGAAGCGGAACCGGCACAAGGACCGGCTGGCG
CGGCGGGCGGCCGAGCAGGAGGCGGCGGCGCGGCAGGCCGAGGTGGAGGCGGCGTCGATGACGGACCACCGGGCG
CGCGAGAGCGCCTACATGAAGAAGATGTTCCAGACGTACGACCTGGTGGAGAAGGAGGTCGAGCCGGACGGCCAC
TGCCTCTTCTCCGCCATGGCCGACCAGCTCAAGCAGCACGGCATCCCGCTCGGGCCCGACCGGCCGCCGGAGCCG
GCCTACAAGGTGGTGCGGCGCGTGGCGGCCGGCTTCATGCTCGACAACGCCGACGACTTCGCCCCCTTCCTCGAC
GAGGACCTCGACGCCTACGCCGCCCGCGTGCGCGACACGGCCGAGTGGGGCGGCCAGCTCGAGCTCATGGCCCTC
GCCCGCCGCTACGGCGCCGAGATCCGCGTCATCCAGGACGGCCGCACCGAGCGCATCGGCGAGGACGAGGGCCGC
GCCACCGGCAAGACGCTGTGGCTGGCCTACTACCGGCACGGCTACGGCCTGGGCGAGCACTACAACTCGCTGCGG
AAGAAGACGGGGTCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail