Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7915
Gene name
LocationContig_489:14310..15334
Strand-
Gene length (bp)1024
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02798 GST_N Glutathione S-transferase, N-terminal domain 5.9E-09 20 91
PF00043 GST_C Glutathione S-transferase, C-terminal domain 2.8E-08 150 215
PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain 2.5E-06 37 91
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 3.3E-06 21 96

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P77526|YFCG_ECOLI Disulfide-bond oxidoreductase YfcG OS=Escherichia coli (strain K12) GN=yfcG PE=1 SV=1 13 221 1.0E-35
sp|Q8SSU2|Y4223_DICDI Glutathione S-transferase domain-containing protein DDB_G0274223 OS=Dictyostelium discoideum GN=DDB_G0274223 PE=3 SV=1 17 232 4.0E-31
sp|Q54UR0|Y0881_DICDI Glutathione S-transferase domain-containing protein DDB_G0280881 OS=Dictyostelium discoideum GN=DDB_G0280881 PE=3 SV=1 17 219 8.0E-31
sp|Q9Y7Q2|GST1_SCHPO Glutathione S-transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst1 PE=2 SV=1 21 216 1.0E-30
sp|O59827|GST2_SCHPO Glutathione S-transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst2 PE=2 SV=1 21 218 8.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P77526|YFCG_ECOLI Disulfide-bond oxidoreductase YfcG OS=Escherichia coli (strain K12) GN=yfcG PE=1 SV=1 13 221 1.0E-35
sp|Q8SSU2|Y4223_DICDI Glutathione S-transferase domain-containing protein DDB_G0274223 OS=Dictyostelium discoideum GN=DDB_G0274223 PE=3 SV=1 17 232 4.0E-31
sp|Q54UR0|Y0881_DICDI Glutathione S-transferase domain-containing protein DDB_G0280881 OS=Dictyostelium discoideum GN=DDB_G0280881 PE=3 SV=1 17 219 8.0E-31
sp|Q9Y7Q2|GST1_SCHPO Glutathione S-transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst1 PE=2 SV=1 21 216 1.0E-30
sp|O59827|GST2_SCHPO Glutathione S-transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst2 PE=2 SV=1 21 218 8.0E-30
sp|Q46845|YGHU_ECOLI Disulfide-bond oxidoreductase YghU OS=Escherichia coli (strain K12) GN=yghU PE=1 SV=2 13 223 2.0E-28
sp|Q555N6|Y4705_DICDI Glutathione S-transferase domain-containing protein DDB_G0274705 OS=Dictyostelium discoideum GN=DDB_G0274705 PE=3 SV=3 17 219 7.0E-28
sp|Q8NJR5|URE2_CANGA Protein URE2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URE2 PE=3 SV=2 19 221 7.0E-28
sp|Q8NJR6|URE2_SACBA Protein URE2 OS=Saccharomyces bayanus GN=URE2 PE=3 SV=1 2 221 9.0E-28
sp|P23202|URE2_YEAST Transcriptional regulator URE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URE2 PE=1 SV=1 2 221 2.0E-27
sp|Q7LLZ8|URE2_SACPA Protein URE2 OS=Saccharomyces paradoxus GN=URE2 PE=3 SV=1 2 221 3.0E-27
sp|A5DDU4|URE2_PICGU Protein URE2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=URE2 PE=3 SV=2 2 221 1.0E-26
sp|Q6BM74|URE2_DEBHA Protein URE2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=URE2 PE=3 SV=2 19 221 2.0E-26
sp|Q8NJR2|URE2_ASHGO Protein URE2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=URE2 PE=3 SV=1 2 221 2.0E-26
sp|Q8NJR4|URE2_KLUMA Protein URE2 OS=Kluyveromyces marxianus GN=URE2 PE=3 SV=1 2 221 6.0E-26
sp|Q8NJR0|URE2_CANMA Protein URE2 OS=Candida maltosa GN=URE2 PE=3 SV=1 19 221 1.0E-25
sp|Q96WL3|URE2_CANAL Protein URE2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URE2 PE=3 SV=1 2 221 2.0E-25
sp|Q96X43|URE2_KLULA Protein URE2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=URE2 PE=3 SV=1 2 221 3.0E-25
sp|Q8DTN7|Y1296_STRMU Uncharacterized GST-like protein SMU_1296 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=SMU_1296 PE=3 SV=1 11 223 7.0E-22
sp|Q9VG94|GSTD6_DROME Glutathione S-transferase D6 OS=Drosophila melanogaster GN=GstD6 PE=1 SV=1 35 211 3.0E-10
sp|P0ACA9|GSTB_SHIFL Glutathione S-transferase GstB OS=Shigella flexneri GN=gstB PE=3 SV=1 52 224 1.0E-09
sp|P0ACA7|GSTB_ECOLI Glutathione S-transferase GstB OS=Escherichia coli (strain K12) GN=gstB PE=1 SV=1 52 224 1.0E-09
sp|P0ACA8|GSTB_ECOL6 Glutathione S-transferase GstB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gstB PE=3 SV=1 52 224 1.0E-09
sp|Q52828|GSTA_RHILE Protein GstA OS=Rhizobium leguminosarum GN=gstA PE=3 SV=1 22 215 2.0E-09
sp|Q64471|GSTT1_MOUSE Glutathione S-transferase theta-1 OS=Mus musculus GN=Gstt1 PE=1 SV=4 58 210 8.0E-08
sp|P04907|GSTF3_MAIZE Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE=1 SV=4 20 222 1.0E-07
sp|Q9P6M1|GST3_SCHPO Glutathione S-transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst3 PE=1 SV=3 29 218 3.0E-07
sp|O80852|GSTF9_ARATH Glutathione S-transferase F9 OS=Arabidopsis thaliana GN=GSTF9 PE=1 SV=1 38 222 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7915
MSRPTGLIASKGIELLTFSTPNGYKASILLEELKEAYGLQYTSQSINIGQNIQKEAWFTAINPNGRIPAIVDHDN
GGLAVFEGSAILSYLTRRYDPDRRFSFAPTDDDYTRAESWVAWQHGGLGPMQGQANHFVRFAKDKIPYAMQRYVG
ESERLYGILDARLRDRDYVVGPGRGKYSIADMALLGWVDFSPVCTLSLDQFPAVKAWFRRCYDRPAVQRGLAVPS
PGSATVHHPPEGEAADKIREAKTLVDQAKEQYGYKYTSP*
Coding >Hirsu2|7915
ATGTCGCGTCCTACCGGCCTGATTGCCTCCAAGGGCATCGAGCTCCTCACCTTCAGCACGCCCAACGGCTACAAG
GCCAGCATCCTGCTCGAGGAGCTCAAGGAGGCGTACGGGCTGCAGTACACCAGCCAGTCCATCAATATCGGACAG
AACATCCAGAAGGAGGCCTGGTTCACGGCCATCAACCCCAACGGCCGCATCCCGGCCATCGTCGACCACGACAAC
GGCGGCCTCGCCGTCTTCGAGGGCAGCGCCATCCTCTCCTACCTGACGCGCCGCTACGACCCGGACCGCCGCTTC
AGCTTCGCCCCCACCGATGACGACTACACGCGCGCCGAGTCCTGGGTAGCCTGGCAGCACGGCGGCCTCGGCCCC
ATGCAGGGCCAGGCGAACCACTTCGTCCGCTTCGCCAAGGACAAGATACCCTACGCCATGCAGCGCTACGTCGGC
GAGTCGGAGCGCCTGTACGGCATCCTCGACGCCCGCCTGCGCGACCGCGACTACGTCGTCGGCCCGGGCAGGGGC
AAGTACAGCATCGCCGACATGGCCCTGCTGGGCTGGGTCGACTTCAGCCCCGTCTGCACCCTCTCGCTCGACCAG
TTCCCGGCCGTCAAGGCCTGGTTCCGCCGCTGCTACGACCGGCCCGCCGTCCAGCGCGGCCTCGCCGTGCCCTCG
CCCGGCTCCGCCACCGTCCACCACCCGCCCGAGGGCGAGGCCGCCGACAAGATCCGGGAGGCCAAGACGCTCGTC
GACCAGGCCAAGGAGCAGTACGGCTACAAGTACACGTCCCCGTGA
Transcript >Hirsu2|7915
ATGTCGCGTCCTACCGGCCTGATTGCCTCCAAGGGCATCGAGCTCCTCACCTTCAGCACGCCCAACGGCTACAAG
GCCAGCATCCTGCTCGAGGAGCTCAAGGAGGCGTACGGGCTGCAGTACACCAGCCAGTCCATCAATATCGGACAG
AACATCCAGAAGGAGGCCTGGTTCACGGCCATCAACCCCAACGGCCGCATCCCGGCCATCGTCGACCACGACAAC
GGCGGCCTCGCCGTCTTCGAGGGCAGCGCCATCCTCTCCTACCTGACGCGCCGCTACGACCCGGACCGCCGCTTC
AGCTTCGCCCCCACCGATGACGACTACACGCGCGCCGAGTCCTGGGTAGCCTGGCAGCACGGCGGCCTCGGCCCC
ATGCAGGGCCAGGCGAACCACTTCGTCCGCTTCGCCAAGGACAAGATACCCTACGCCATGCAGCGCTACGTCGGC
GAGTCGGAGCGCCTGTACGGCATCCTCGACGCCCGCCTGCGCGACCGCGACTACGTCGTCGGCCCGGGCAGGGGC
AAGTACAGCATCGCCGACATGGCCCTGCTGGGCTGGGTCGACTTCAGCCCCGTCTGCACCCTCTCGCTCGACCAG
TTCCCGGCCGTCAAGGCCTGGTTCCGCCGCTGCTACGACCGGCCCGCCGTCCAGCGCGGCCTCGCCGTGCCCTCG
CCCGGCTCCGCCACCGTCCACCACCCGCCCGAGGGCGAGGCCGCCGACAAGATCCGGGAGGCCAAGACGCTCGTC
GACCAGGCCAAGGAGCAGTACGGCTACAAGTACACGTCCCCGTGA
Gene >Hirsu2|7915
ATGTCGCGTCCTACCGGCCTGATTGCCTCCAAGGGCATCGAGCTCCTCACCTTCAGTACGTTTCCCAGCTGCCCA
AAATACGACGGTCCAGACCTCCCTGCTGGGACGCGTGGCCTTGCCTACGCACGCACGCACGCACACGCGCGCGCG
CCTGCTCGCCCTCGCACCACCACCCGATCCTTCGGGACGAGCAGCGCAGAGCAGAGCCTCCCGCCTCATCCGCGC
TGCCCTCCCCCCTATCCCCCCCCCCTGTTGCGCCACCGTCTCTGACTGTCGGGCCACAGGCACGCCCAACGGCTA
CAAGGCCAGCATCCTGCTCGAGGAGCTCAAGGAGGCGTACGGGCTGCAGTACACCAGCCAGTCCATCAATATCGG
ACAGAACATCCAGAAGGAGGCCTGGTTCACGGCCATCAACCCCAACGGCCGCATCCCGGCCATCGTCGACCACGA
CAACGGCGGCCTCGCCGTCTTCGAGGGCAGCGCCATCCTCTCCTACCTGACGCGCCGCTACGACCCGGACCGCCG
CTTCAGCTTCGCCCCCACCGATGACGACTACACGCGCGCCGAGTCCTGGGTAGCCTGGCAGCACGGCGGCCTCGG
CCCCATGCAGGGCCAGGCGAACCACTTCGTCCGCTTCGCCAAGGACAAGATACCCTACGCCATGCAGCGCTACGT
CGGCGAGTCGGAGCGCCTGTACGGCATCCTCGACGCCCGCCTGCGCGACCGCGACTACGTCGTCGGCCCGGGCAG
GGGCAAGTACAGCATCGCCGACATGGCCCTGCTGGGCTGGGTCGACTTCAGCCCCGTCTGCACCCTCTCGCTCGA
CCAGTTCCCGGCCGTCAAGGCCTGGTTCCGCCGCTGCTACGACCGGCCCGCCGTCCAGCGCGGCCTCGCCGTGCC
CTCGCCCGGCTCCGCCACCGTCCACCACCCGCCCGAGGGCGAGGCCGCCGACAAGATCCGGGAGGCCAAGACGCT
CGTCGACCAGGCCAAGGAGCAGTACGGCTACAAGTACACGTCCCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail