Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7911
Gene name
LocationContig_489:8993..10153
Strand+
Gene length (bp)1160
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00742 Homoserine_dh Homoserine dehydrogenase 1.7E-52 155 358
PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain 2.3E-18 13 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B998|DHOM_EMENI Homoserine dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN2882 PE=1 SV=1 20 364 1.0E-131
sp|O94671|DHOM_SCHPO Probable homoserine dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC776.03 PE=1 SV=1 3 364 6.0E-109
sp|P31116|DHOM_YEAST Homoserine dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOM6 PE=1 SV=1 9 364 2.0E-108
sp|P49079|AKH1_MAIZE Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic OS=Zea mays GN=AKHSDH1 PE=2 SV=1 3 364 8.0E-83
sp|Q9SA18|AKH1_ARATH Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=AKHSDH1 PE=1 SV=1 89 360 4.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B998|DHOM_EMENI Homoserine dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN2882 PE=1 SV=1 20 364 1.0E-131
sp|O94671|DHOM_SCHPO Probable homoserine dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC776.03 PE=1 SV=1 3 364 6.0E-109
sp|P31116|DHOM_YEAST Homoserine dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOM6 PE=1 SV=1 9 364 2.0E-108
sp|P49079|AKH1_MAIZE Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic OS=Zea mays GN=AKHSDH1 PE=2 SV=1 3 364 8.0E-83
sp|Q9SA18|AKH1_ARATH Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=AKHSDH1 PE=1 SV=1 89 360 4.0E-79
sp|P49080|AKH2_MAIZE Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic OS=Zea mays GN=AKHSDH2 PE=2 SV=1 91 364 3.0E-78
sp|P37142|AKH_DAUCA Bifunctional aspartokinase/homoserine dehydrogenase, chloroplastic (Fragment) OS=Daucus carota PE=1 SV=1 3 364 1.0E-76
sp|O81852|AKH2_ARATH Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=AKHSDH2 PE=1 SV=1 3 364 4.0E-74
sp|P27725|AK1H_SERMA Bifunctional aspartokinase/homoserine dehydrogenase 1 OS=Serratia marcescens GN=thrA PE=3 SV=1 37 362 6.0E-63
sp|Q89AR4|AKH_BUCBP Bifunctional aspartokinase/homoserine dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=thrA PE=3 SV=1 9 361 4.0E-61
sp|Q8K9U9|AKH_BUCAP Bifunctional aspartokinase/homoserine dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=thrA PE=3 SV=1 4 361 2.0E-57
sp|P44505|AKH_HAEIN Bifunctional aspartokinase/homoserine dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thrA PE=3 SV=1 32 363 3.0E-57
sp|P57290|AKH_BUCAI Bifunctional aspartokinase/homoserine dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=thrA PE=3 SV=1 4 362 7.0E-57
sp|P00561|AK1H_ECOLI Bifunctional aspartokinase/homoserine dehydrogenase 1 OS=Escherichia coli (strain K12) GN=thrA PE=1 SV=2 37 362 3.0E-55
sp|P00562|AK2H_ECOLI Bifunctional aspartokinase/homoserine dehydrogenase 2 OS=Escherichia coli (strain K12) GN=metL PE=1 SV=3 3 360 9.0E-51
sp|P52985|DHOM_LACLC Homoserine dehydrogenase OS=Lactococcus lactis subsp. cremoris GN=hom PE=3 SV=1 108 364 7.0E-19
sp|P19582|DHOM_BACSU Homoserine dehydrogenase OS=Bacillus subtilis (strain 168) GN=hom PE=1 SV=2 108 364 8.0E-19
sp|P52986|DHOM_SYNY3 Homoserine dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hom PE=3 SV=1 73 365 1.0E-17
sp|Q9CGD8|DHOM_LACLA Homoserine dehydrogenase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=hom PE=3 SV=1 112 363 4.0E-17
sp|P29365|DHOM_PSEAE Homoserine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hom PE=3 SV=2 108 365 3.0E-16
sp|P08499|DHOM_CORGL Homoserine dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hom PE=1 SV=1 108 358 8.0E-15
sp|Q58997|DHOM_METJA Homoserine dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hom PE=3 SV=1 115 360 3.0E-13
sp|Q9ZL20|DHOM_HELPJ Homoserine dehydrogenase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=hom PE=3 SV=1 109 365 2.0E-12
sp|P56429|DHOM_HELPY Homoserine dehydrogenase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=hom PE=3 SV=1 109 365 3.0E-12
sp|P46806|DHOM_MYCLE Homoserine dehydrogenase OS=Mycobacterium leprae (strain TN) GN=hom PE=3 SV=1 108 358 3.0E-11
sp|P9WPX1|DHOM_MYCTU Homoserine dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hom PE=1 SV=1 108 223 5.0E-07
sp|P9WPX0|DHOM_MYCTO Homoserine dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hom PE=3 SV=1 108 223 5.0E-07
sp|P63630|DHOM_MYCBO Homoserine dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=hom PE=3 SV=1 108 223 5.0E-07
sp|P37144|DHON_METGL Homoserine dehydrogenase OS=Methylobacillus glycogenes GN=hom PE=3 SV=1 168 241 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006520 cellular amino acid metabolic process Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity Yes
GO:0050661 NADP binding Yes
GO:0019752 carboxylic acid metabolic process No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0043436 oxoacid metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0048037 cofactor binding No
GO:0050662 coenzyme binding No
GO:0006082 organic acid metabolic process No
GO:0003824 catalytic activity No
GO:0000166 nucleotide binding No
GO:0044281 small molecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7911
MDAKSRILIAVIGVGGVGKCFLSQLRSLAARKPSPKLSLCYISTSRKALYNDDYTEINMDGAIEALAASSQSPPA
LSKVIDYLAAAPAKAILVDNTSSQDVADLYPLALGRGVSVVTPNKKAFSGSHQLWQDIFKSAAASGAKVYHESSV
GAGLPIISTLKDLVETGDRVTKIEGVFSGTMSFLFNSFAPTTGRGGSWSDEVKKAKSLGYTEPDPRDDLNGLDVA
RKLTILARLAGLPVESPTAFPVQSLIPRELESCGSGDEFLEKLPAFDGQMEETKAAAEKAGKVVRFVGSIDVGAN
EVKVGLEMFEPSHPIAALKGSDNIISFYTERYGSNPLIVQGAGAGGEVTAMGVTGDLLKVVSQIS*
Coding >Hirsu2|7911
ATGGACGCCAAAAGCAGAATCTTGATTGCCGTTATCGGCGTTGGCGGCGTGGGCAAATGCTTCCTCTCCCAGCTG
CGAAGCCTTGCGGCTCGAAAGCCGTCGCCCAAGCTCAGCCTCTGCTACATCTCGACAAGTCGCAAGGCGCTCTAC
AACGACGATTACACCGAAATCAACATGGACGGAGCCATCGAGGCCCTCGCCGCCTCGTCCCAGTCTCCCCCCGCC
CTTTCCAAAGTCATTGATTACCTTGCAGCCGCCCCCGCCAAGGCCATCCTCGTCGATAACACCAGCTCGCAAGAC
GTAGCCGACCTGTACCCGCTCGCCCTCGGCCGAGGCGTAAGCGTTGTTACACCCAACAAGAAGGCCTTCTCCGGC
TCCCATCAGCTCTGGCAGGACATCTTCAAGTCTGCCGCCGCTTCGGGCGCAAAGGTCTACCATGAGTCGTCCGTG
GGGGCCGGCCTGCCCATCATCTCCACGCTCAAGGACCTTGTCGAGACCGGAGATAGGGTGACCAAGATCGAGGGT
GTCTTCAGCGGCACCATGTCCTTCCTCTTCAACTCGTTCGCCCCTACCACCGGCCGCGGGGGCTCGTGGTCCGAC
GAGGTCAAAAAGGCCAAATCGCTCGGCTATACGGAGCCGGACCCGCGAGACGACCTGAACGGGCTCGACGTTGCG
CGCAAACTGACAATCCTGGCGCGTCTCGCCGGCCTACCGGTCGAGTCTCCGACCGCATTTCCCGTGCAGAGCCTG
ATCCCCAGGGAGCTCGAGTCTTGCGGCAGCGGCGACGAGTTTCTCGAGAAGCTGCCCGCGTTCGATGGCCAGATG
GAGGAAACAAAGGCGGCGGCCGAGAAGGCAGGCAAGGTGGTCCGATTCGTCGGCAGCATCGACGTGGGCGCCAAC
GAGGTCAAGGTCGGACTGGAAATGTTCGAGCCTTCGCACCCGATCGCCGCTCTCAAGGGGAGCGACAACATCATC
AGCTTCTACACCGAGCGATATGGAAGCAACCCCTTGATCGTGCAGGGCGCCGGGGCCGGCGGCGAAGTCACGGCG
ATGGGGGTGACGGGCGACCTGCTCAAGGTCGTCTCCCAGATCTCATAG
Transcript >Hirsu2|7911
ATGGACGCCAAAAGCAGAATCTTGATTGCCGTTATCGGCGTTGGCGGCGTGGGCAAATGCTTCCTCTCCCAGCTG
CGAAGCCTTGCGGCTCGAAAGCCGTCGCCCAAGCTCAGCCTCTGCTACATCTCGACAAGTCGCAAGGCGCTCTAC
AACGACGATTACACCGAAATCAACATGGACGGAGCCATCGAGGCCCTCGCCGCCTCGTCCCAGTCTCCCCCCGCC
CTTTCCAAAGTCATTGATTACCTTGCAGCCGCCCCCGCCAAGGCCATCCTCGTCGATAACACCAGCTCGCAAGAC
GTAGCCGACCTGTACCCGCTCGCCCTCGGCCGAGGCGTAAGCGTTGTTACACCCAACAAGAAGGCCTTCTCCGGC
TCCCATCAGCTCTGGCAGGACATCTTCAAGTCTGCCGCCGCTTCGGGCGCAAAGGTCTACCATGAGTCGTCCGTG
GGGGCCGGCCTGCCCATCATCTCCACGCTCAAGGACCTTGTCGAGACCGGAGATAGGGTGACCAAGATCGAGGGT
GTCTTCAGCGGCACCATGTCCTTCCTCTTCAACTCGTTCGCCCCTACCACCGGCCGCGGGGGCTCGTGGTCCGAC
GAGGTCAAAAAGGCCAAATCGCTCGGCTATACGGAGCCGGACCCGCGAGACGACCTGAACGGGCTCGACGTTGCG
CGCAAACTGACAATCCTGGCGCGTCTCGCCGGCCTACCGGTCGAGTCTCCGACCGCATTTCCCGTGCAGAGCCTG
ATCCCCAGGGAGCTCGAGTCTTGCGGCAGCGGCGACGAGTTTCTCGAGAAGCTGCCCGCGTTCGATGGCCAGATG
GAGGAAACAAAGGCGGCGGCCGAGAAGGCAGGCAAGGTGGTCCGATTCGTCGGCAGCATCGACGTGGGCGCCAAC
GAGGTCAAGGTCGGACTGGAAATGTTCGAGCCTTCGCACCCGATCGCCGCTCTCAAGGGGAGCGACAACATCATC
AGCTTCTACACCGAGCGATATGGAAGCAACCCCTTGATCGTGCAGGGCGCCGGGGCCGGCGGCGAAGTCACGGCG
ATGGGGGTGACGGGCGACCTGCTCAAGGTCGTCTCCCAGATCTCATAG
Gene >Hirsu2|7911
ATGGACGCCAAAAGCAGAATCTTGATTGCCGTTATCGGTCGGTGTGCTCGCCCTCGTATGCTGGCTGGCCCCTGC
TGACCGACCGGGTCGCCCGCGCAGGCGTTGGCGGCGTGGGCAAATGCTTCCTCTCCCAGCTGCGAAGCCTTGCGG
CTCGAAAGCCGTCGCCCAAGCTCAGCCTCTGCTACATCTCGACAAGTCGCAAGGCGCTCTACAACGACGATTACA
CCGAAATCAACATGGACGGAGCCATCGAGGCCCTCGCCGCCTCGTCCCAGTCTCCCCCCGCCCTTTCCAAAGTCA
TTGATTACCTTGCAGCCGCCCCCGCCAAGGCCATCCTCGTCGATAACACCAGCTCGCAAGACGTAGCCGACCTGT
ACCCGCTCGCCCTCGGCCGAGGCGTAAGCGTTGTTACACCCAACAAGAAGGCCTTCTCCGGCTCCCATCAGCTCT
GGCAGGACATCTTCAAGTCTGCCGCCGCTTCGGGCGCAAAGGTCTACCATGAGTCGTCCGTGGGGGCCGGCCTGC
CCATCATCTCCACGCTCAAGGACCTTGTCGAGACCGGAGATAGGGTGACCAAGATCGAGGGTGTCTTCAGCGGCA
CCATGTCCTTCCTCTTCAACTCGTTCGCCCCTACCACCGGCCGCGGGGGCTCGTGGTCCGACGAGGTCAAAAAGG
CCAAATCGCTCGGCTATACGGAGCCGGACCCGCGAGACGACCTGAACGGGCTCGACGTTGCGCGCAAACTGACAA
TCCTGGCGCGTCTCGCCGGCCTACCGGTCGAGTCTCCGACCGCATTTCCCGTGCAGAGCCTGATCCCCAGGGAGC
TCGAGTCTTGCGGCAGCGGCGACGAGTTTCTCGAGAAGCTGCCCGCGTTCGATGGCCAGATGGAGGAAACAAAGG
CGGCGGCCGAGAAGGCAGGCAAGGTGGTCCGATTCGTCGGCAGCATCGACGTGGGCGCCAACGAGGTCAAGGTCG
GACTGGAAATGTTCGAGCCTTCGCACCCGATCGCCGCTCTCAAGGGGAGCGACAACATCATCAGCTTCTACACCG
AGCGATATGGAAGCAACCCCTTGATCGTGCAGGGCGCCGGGGCCGGCGGCGAAGTCACGGCGATGGGGGTGACGG
GCGACCTGCTCAAGGTCGTCTCCCAGATCTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail