Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7908
Gene name
LocationContig_489:2836..3938
Strand-
Gene length (bp)1102
Transcript length (bp)939
Coding sequence length (bp)939
Protein length (aa) 313

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 1.7E-17 41 147

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B5ZA76|PGDAE_HELPG Peptidoglycan deacetylase OS=Helicobacter pylori (strain G27) GN=pgdA PE=1 SV=1 4 292 1.0E-123
sp|O25080|PGDAE_HELPY Peptidoglycan deacetylase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pgdA PE=1 SV=1 4 292 9.0E-122
sp|O13842|CDA1_SCHPO Chitin deacetylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cda1 PE=1 SV=1 38 292 4.0E-08
sp|Q04729|YFUM2_GEOSE Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus PE=3 SV=1 44 127 6.0E-08
sp|O34928|PDAA_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaA OS=Bacillus subtilis (strain 168) GN=pdaA PE=1 SV=1 44 129 2.0E-07

GO

GO Term Description Terminal node
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7908
MGKKRVQITYGVDVDAVAGWLGSYGGQDSPHDISRGIFAATVGTERLLKLFAKYDIKATWFIPGHSLESFPEEMA
RVRDAGHELGLHGYSHENPTAMTASQQRDVMDKSWRLLADFCGGRPPRGIVTPWWETSGDWARLLLAYGLEYDHS
MSHEDSRPYWLPADESWARIDYARPARSWMRPLGRGRPTGIVEVPANWCLDDLPPLMFVKAAANSHGFVNARDVE
DTWRDHFDYLYREHDDFVLPLTLHPDVSGRPHALLMHERLIEHFRRHDGVEFVTMGRVVDDFKSRNPPPEGAPMP
AAPGAALGAEGP*
Coding >Hirsu2|7908
ATGGGCAAGAAACGGGTTCAGATCACGTATGGCGTCGATGTCGATGCTGTGGCTGGATGGCTGGGCTCGTATGGC
GGGCAGGACTCGCCGCACGACATAAGCCGAGGCATCTTCGCGGCGACGGTCGGGACGGAGCGGCTGCTGAAGCTG
TTCGCCAAGTACGACATCAAGGCGACGTGGTTCATCCCCGGGCACAGCCTGGAGTCGTTCCCGGAGGAGATGGCG
CGGGTGCGGGACGCGGGCCACGAGCTGGGCCTGCACGGCTACTCGCACGAGAACCCGACGGCGATGACGGCGTCG
CAGCAGCGCGACGTGATGGACAAGTCGTGGCGGCTGCTGGCCGACTTCTGCGGCGGGCGGCCGCCGCGCGGCATC
GTGACGCCGTGGTGGGAGACGAGCGGCGACTGGGCGCGGCTGCTGCTGGCGTACGGGCTCGAGTACGACCACTCG
ATGAGCCACGAGGACAGCCGGCCGTACTGGCTGCCGGCCGACGAGAGCTGGGCGCGCATCGACTACGCCCGGCCG
GCGCGCAGCTGGATGCGGCCGCTGGGGCGCGGGCGGCCGACGGGCATCGTCGAGGTGCCGGCCAACTGGTGCCTC
GACGACCTGCCGCCGCTCATGTTCGTCAAGGCGGCCGCCAACAGCCACGGCTTCGTCAACGCGCGCGACGTCGAG
GACACGTGGCGCGACCACTTCGACTACCTGTACCGCGAGCACGACGACTTCGTCCTGCCGCTGACGCTGCACCCG
GACGTCAGCGGCCGCCCGCACGCGCTGCTGATGCACGAGCGCCTCATCGAGCACTTCCGCCGCCACGACGGCGTC
GAGTTCGTCACCATGGGCCGCGTCGTCGACGACTTCAAGAGCCGCAACCCGCCGCCCGAGGGGGCCCCGATGCCG
GCTGCGCCCGGCGCTGCCCTGGGCGCGGAGGGGCCGTGA
Transcript >Hirsu2|7908
ATGGGCAAGAAACGGGTTCAGATCACGTATGGCGTCGATGTCGATGCTGTGGCTGGATGGCTGGGCTCGTATGGC
GGGCAGGACTCGCCGCACGACATAAGCCGAGGCATCTTCGCGGCGACGGTCGGGACGGAGCGGCTGCTGAAGCTG
TTCGCCAAGTACGACATCAAGGCGACGTGGTTCATCCCCGGGCACAGCCTGGAGTCGTTCCCGGAGGAGATGGCG
CGGGTGCGGGACGCGGGCCACGAGCTGGGCCTGCACGGCTACTCGCACGAGAACCCGACGGCGATGACGGCGTCG
CAGCAGCGCGACGTGATGGACAAGTCGTGGCGGCTGCTGGCCGACTTCTGCGGCGGGCGGCCGCCGCGCGGCATC
GTGACGCCGTGGTGGGAGACGAGCGGCGACTGGGCGCGGCTGCTGCTGGCGTACGGGCTCGAGTACGACCACTCG
ATGAGCCACGAGGACAGCCGGCCGTACTGGCTGCCGGCCGACGAGAGCTGGGCGCGCATCGACTACGCCCGGCCG
GCGCGCAGCTGGATGCGGCCGCTGGGGCGCGGGCGGCCGACGGGCATCGTCGAGGTGCCGGCCAACTGGTGCCTC
GACGACCTGCCGCCGCTCATGTTCGTCAAGGCGGCCGCCAACAGCCACGGCTTCGTCAACGCGCGCGACGTCGAG
GACACGTGGCGCGACCACTTCGACTACCTGTACCGCGAGCACGACGACTTCGTCCTGCCGCTGACGCTGCACCCG
GACGTCAGCGGCCGCCCGCACGCGCTGCTGATGCACGAGCGCCTCATCGAGCACTTCCGCCGCCACGACGGCGTC
GAGTTCGTCACCATGGGCCGCGTCGTCGACGACTTCAAGAGCCGCAACCCGCCGCCCGAGGGGGCCCCGATGCCG
GCTGCGCCCGGCGCTGCCCTGGGCGCGGAGGGGCCGTGA
Gene >Hirsu2|7908
ATGGGCAAGAAACGGGTTCAGATCACGTATGGCGTCGATGTCGATGCTGTGGCTGGATGGCTGGGCTCGTATGGC
GGGCAGGACTCGCCGCACGACATAAGCCGAGGTTCTGTCGAGCCCATCCTAGTCCTCCTCTTCCTTCACCTTCTC
CTCGTCCCCCCTCCCCCCCTTCCTCCTGCTCCTCCTCCACCTCCTCTCCCGCCTCCGGGCCGGCGTTTGTCCCCG
CTCGTCGTCCGTGGTTCGCGTGCTGACGGTGGCCGTGCGGGCAGGCATCTTCGCGGCGACGGTCGGGACGGAGCG
GCTGCTGAAGCTGTTCGCCAAGTACGACATCAAGGCGACGTGGTTCATCCCCGGGCACAGCCTGGAGTCGTTCCC
GGAGGAGATGGCGCGGGTGCGGGACGCGGGCCACGAGCTGGGCCTGCACGGCTACTCGCACGAGAACCCGACGGC
GATGACGGCGTCGCAGCAGCGCGACGTGATGGACAAGTCGTGGCGGCTGCTGGCCGACTTCTGCGGCGGGCGGCC
GCCGCGCGGCATCGTGACGCCGTGGTGGGAGACGAGCGGCGACTGGGCGCGGCTGCTGCTGGCGTACGGGCTCGA
GTACGACCACTCGATGAGCCACGAGGACAGCCGGCCGTACTGGCTGCCGGCCGACGAGAGCTGGGCGCGCATCGA
CTACGCCCGGCCGGCGCGCAGCTGGATGCGGCCGCTGGGGCGCGGGCGGCCGACGGGCATCGTCGAGGTGCCGGC
CAACTGGTGCCTCGACGACCTGCCGCCGCTCATGTTCGTCAAGGCGGCCGCCAACAGCCACGGCTTCGTCAACGC
GCGCGACGTCGAGGACACGTGGCGCGACCACTTCGACTACCTGTACCGCGAGCACGACGACTTCGTCCTGCCGCT
GACGCTGCACCCGGACGTCAGCGGCCGCCCGCACGCGCTGCTGATGCACGAGCGCCTCATCGAGCACTTCCGCCG
CCACGACGGCGTCGAGTTCGTCACCATGGGCCGCGTCGTCGACGACTTCAAGAGCCGCAACCCGCCGCCCGAGGG
GGCCCCGATGCCGGCTGCGCCCGGCGCTGCCCTGGGCGCGGAGGGGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail