Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7905
Gene name
LocationContig_488:17394..18101
Strand+
Gene length (bp)707
Transcript length (bp)561
Coding sequence length (bp)561
Protein length (aa) 187

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00627 UBA UBA/TS-N domain 2.2E-05 3 35

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5705 0.6037 0.1501 0.042 0.2167 0.004 0.1566 0.0934 0.1213 0.0284

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3965
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5742
Ophiocordyceps australis map64 (Brazil) OphauB2|4859
Ophiocordyceps camponoti-floridani Ophcf2|06869
Ophiocordyceps camponoti-rufipedis Ophun1|4743
Ophiocordyceps kimflemingae Ophio5|921
Ophiocordyceps subramaniannii Hirsu2|7905 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7905
MPSDLEQLLDMGFEKARAELAVKKTGGLQGALQWLEDNQDKSLDEIQAAQAGKREGGGDADDDDEETKAQIAEIE
SGQARSLVCNECGKRFRNHDLASYHATKTEHTDFSESTEEIAPLTEDEKKAKLDELRERLRAKKSAQSVQDKEDQ
KRNEVRPRSHVQLPLFLLTPPAPPTGPAAAFVLPRE*
Coding >Hirsu2|7905
ATGCCGTCGGACCTGGAGCAGCTGCTCGACATGGGCTTCGAGAAAGCCCGGGCCGAGCTCGCCGTCAAGAAGACG
GGCGGCCTCCAGGGCGCGCTGCAGTGGCTCGAGGACAACCAGGACAAGTCGCTCGACGAGATCCAGGCCGCGCAG
GCGGGCAAGCGCGAAGGCGGCGGCGACGCCGACGACGACGACGAAGAGACCAAGGCCCAGATCGCCGAGATCGAA
TCGGGCCAGGCCCGCTCGCTCGTCTGCAACGAGTGCGGCAAGCGCTTTCGCAACCACGACCTGGCCAGCTACCAT
GCCACCAAGACCGAACACACAGACTTCTCCGAGTCCACCGAGGAGATCGCCCCCCTGACCGAGGACGAGAAGAAG
GCCAAGCTCGATGAGCTCCGTGAGCGTCTCCGCGCCAAGAAGAGCGCCCAGTCCGTCCAGGACAAGGAGGACCAG
AAGCGTAACGAGGTGAGGCCCCGGTCACACGTCCAGCTTCCCCTATTCCTCCTCACCCCCCCGGCCCCGCCCACG
GGCCCAGCCGCTGCGTTCGTTTTGCCGCGGGAATAG
Transcript >Hirsu2|7905
ATGCCGTCGGACCTGGAGCAGCTGCTCGACATGGGCTTCGAGAAAGCCCGGGCCGAGCTCGCCGTCAAGAAGACG
GGCGGCCTCCAGGGCGCGCTGCAGTGGCTCGAGGACAACCAGGACAAGTCGCTCGACGAGATCCAGGCCGCGCAG
GCGGGCAAGCGCGAAGGCGGCGGCGACGCCGACGACGACGACGAAGAGACCAAGGCCCAGATCGCCGAGATCGAA
TCGGGCCAGGCCCGCTCGCTCGTCTGCAACGAGTGCGGCAAGCGCTTTCGCAACCACGACCTGGCCAGCTACCAT
GCCACCAAGACCGAACACACAGACTTCTCCGAGTCCACCGAGGAGATCGCCCCCCTGACCGAGGACGAGAAGAAG
GCCAAGCTCGATGAGCTCCGTGAGCGTCTCCGCGCCAAGAAGAGCGCCCAGTCCGTCCAGGACAAGGAGGACCAG
AAGCGTAACGAGGTGAGGCCCCGGTCACACGTCCAGCTTCCCCTATTCCTCCTCACCCCCCCGGCCCCGCCCACG
GGCCCAGCCGCTGCGTTCGTTTTGCCGCGGGAATAG
Gene >Hirsu2|7905
ATGCCGTCGGACCTGGAGCAGCTGCTCGACATGGGCTTCGAGAAAGCCCGGGCCGAGCTCGCCGTCAAGAAGACG
GGCGGCCGTGTGTCCCCCTCCCCCTAACTCCCCATCCCCAGCGTCGGCTCACGCCCCTGACACGCTCTGTCCCTG
TCCAGTCCAGGGCGCGCTGCAGTGGCTCGAGGACAACCAGGACAAGTCGCTCGACGAGATCCAGGCCGCGCAGGC
GGGCAAGCGCGAAGGCGGCGGCGACGCCGACGACGACGACGAAGAGACCAAGGCCCAGATCGCCGAGATCGAATC
GGGCCAGGCCCGCTCGCTCGTCTGCAACGAGTGCGGCAAGCGCTTTCGCAACCACGACCTGGCCAGCTACCATGC
CACCAAGACGTCCGTCCGACACTCAGCCTCTCTCTCTCTCATCCCCCTCCCGTCAGGGCCCGTGGCTGACCCGTC
ACGTTAGCGAACACACAGACTTCTCCGAGTCCACCGAGGAGATCGCCCCCCTGACCGAGGACGAGAAGAAGGCCA
AGCTCGATGAGCTCCGTGAGCGTCTCCGCGCCAAGAAGAGCGCCCAGTCCGTCCAGGACAAGGAGGACCAGAAGC
GTAACGAGGTGAGGCCCCGGTCACACGTCCAGCTTCCCCTATTCCTCCTCACCCCCCCGGCCCCGCCCACGGGCC
CAGCCGCTGCGTTCGTTTTGCCGCGGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail