Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7902
Gene name
LocationContig_488:8539..10278
Strand+
Gene length (bp)1739
Transcript length (bp)1590
Coding sequence length (bp)1590
Protein length (aa) 530

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 6.7E-26 98 503

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38680|MTR_NEUCR N amino acid transport system protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtr PE=3 SV=2 55 524 4.0E-61

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

Domain # Start End Length
1 106 128 22
2 133 155 22
3 176 198 22
4 213 232 19
5 244 266 22
6 294 316 22
7 328 350 22
8 374 396 22
9 408 430 22
10 440 462 22
11 482 504 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7902
MAAKSEPLKSGLASRSGSDELIAATRDAEYASDKGKTQILASLFGGKAVAIGPRIAPLPDWLKNDVGMADDSGED
LSSAAILDRQLDSENGHSIQYRTCSWQKTAALLFSEYICLAIMSFPWSYSFLGLVPGLILTAVVAVVVLYTSLVL
WEFCLRHPEVRDVCDLGQMLFWGRPWAWWGTALMFVLNNTFIQGLHVLVGAEYLNTMTAADHIAGCRTVQFSIAL
TFICWLASLPRTFSMLSKLGTAAALFTFISVILATAFAGVQGRPAGYTPAKGDPIVTAFPVASTTFVQGMAAFLN
ISYTFIGQITLPSFIAEMRDPREFPKSLWACTIAEIITFSVVGAVIYAYTGNQYVKAPAFGSLEDVYKKVSFSFM
IPTIIFLGCLYASVTARFVFFRIFRNSRHLNDHTLVGWGSWGGILLVTWLLAFLISQLIPFFSSLLSVMSSLFDS
WFGFIFWGVAYFRMRRADRKVGRCRTPLLDYLSMALNVVIILTGVFFLTAGTYASVQGIVDAFNAGEVGGVFSCK
SNAV*
Coding >Hirsu2|7902
ATGGCCGCCAAGTCGGAACCGCTCAAGTCGGGGCTCGCGTCCCGCTCCGGGTCGGACGAGCTCATCGCCGCGACC
CGTGACGCCGAGTATGCGTCGGACAAAGGCAAGACGCAGATCCTGGCGTCCTTGTTCGGCGGCAAGGCCGTGGCC
ATCGGCCCGCGCATCGCGCCGCTGCCCGACTGGCTCAAGAACGACGTGGGCATGGCCGACGACAGCGGCGAGGAC
CTGAGCAGCGCCGCCATCCTCGACCGCCAGCTCGACTCGGAGAACGGGCACTCGATCCAGTACCGCACGTGCAGC
TGGCAGAAGACGGCGGCGCTGCTGTTCAGCGAGTACATCTGCCTGGCCATCATGAGCTTTCCCTGGTCCTACAGC
TTCCTCGGCCTGGTGCCCGGCCTGATCCTGACGGCCGTCGTCGCCGTCGTCGTCCTCTACACCAGCCTCGTCCTG
TGGGAGTTCTGCCTGCGCCATCCCGAGGTCCGCGACGTCTGCGACCTCGGCCAGATGCTCTTCTGGGGCCGGCCC
TGGGCCTGGTGGGGCACCGCCCTCATGTTCGTCCTGAACAACACCTTCATCCAGGGCCTGCACGTCCTCGTCGGC
GCCGAGTACCTCAACACCATGACGGCCGCCGACCACATCGCCGGCTGCCGCACCGTCCAGTTCTCCATCGCCCTC
ACCTTCATCTGCTGGCTGGCCTCGCTGCCGCGCACCTTTAGCATGCTGTCCAAGCTCGGCACCGCCGCGGCCCTC
TTCACCTTCATCTCCGTCATCCTCGCCACCGCCTTCGCCGGCGTCCAGGGCCGCCCGGCCGGCTACACCCCGGCC
AAGGGTGACCCCATCGTCACCGCCTTCCCCGTCGCCAGCACCACCTTTGTCCAGGGCATGGCCGCCTTCCTCAAC
ATCAGCTACACCTTTATCGGCCAGATCACCCTACCCAGTTTCATCGCCGAGATGCGCGACCCCAGAGAATTTCCC
AAGTCGCTGTGGGCGTGCACCATTGCCGAAATCATCACGTTCAGCGTCGTCGGCGCCGTCATCTACGCCTACACC
GGCAACCAGTACGTCAAGGCCCCGGCCTTTGGCTCCCTCGAAGACGTGTACAAAAAGGTGTCCTTCTCCTTCATG
ATCCCGACCATCATCTTCCTCGGCTGCCTGTACGCGTCCGTCACGGCCCGCTTCGTCTTCTTCCGCATCTTCCGC
AACTCGCGCCATCTCAACGACCACACCCTTGTCGGCTGGGGCTCATGGGGCGGCATTCTGCTCGTCACCTGGCTG
CTGGCCTTTCTCATCTCGCAGCTCATCCCCTTCTTCTCGTCCCTGCTGTCCGTCATGTCGTCGCTCTTCGACAGC
TGGTTCGGCTTCATCTTCTGGGGCGTCGCCTACTTCCGCATGCGCCGCGCGGACCGAAAGGTCGGCCGGTGCCGA
ACCCCCCTGCTGGACTACCTGTCGATGGCGCTCAACGTCGTCATCATTCTGACCGGCGTCTTCTTCCTCACCGCC
GGCACGTACGCCAGCGTGCAGGGCATCGTCGACGCCTTCAACGCGGGCGAGGTCGGCGGAGTCTTTTCCTGCAAA
AGTAACGCCGTATGA
Transcript >Hirsu2|7902
ATGGCCGCCAAGTCGGAACCGCTCAAGTCGGGGCTCGCGTCCCGCTCCGGGTCGGACGAGCTCATCGCCGCGACC
CGTGACGCCGAGTATGCGTCGGACAAAGGCAAGACGCAGATCCTGGCGTCCTTGTTCGGCGGCAAGGCCGTGGCC
ATCGGCCCGCGCATCGCGCCGCTGCCCGACTGGCTCAAGAACGACGTGGGCATGGCCGACGACAGCGGCGAGGAC
CTGAGCAGCGCCGCCATCCTCGACCGCCAGCTCGACTCGGAGAACGGGCACTCGATCCAGTACCGCACGTGCAGC
TGGCAGAAGACGGCGGCGCTGCTGTTCAGCGAGTACATCTGCCTGGCCATCATGAGCTTTCCCTGGTCCTACAGC
TTCCTCGGCCTGGTGCCCGGCCTGATCCTGACGGCCGTCGTCGCCGTCGTCGTCCTCTACACCAGCCTCGTCCTG
TGGGAGTTCTGCCTGCGCCATCCCGAGGTCCGCGACGTCTGCGACCTCGGCCAGATGCTCTTCTGGGGCCGGCCC
TGGGCCTGGTGGGGCACCGCCCTCATGTTCGTCCTGAACAACACCTTCATCCAGGGCCTGCACGTCCTCGTCGGC
GCCGAGTACCTCAACACCATGACGGCCGCCGACCACATCGCCGGCTGCCGCACCGTCCAGTTCTCCATCGCCCTC
ACCTTCATCTGCTGGCTGGCCTCGCTGCCGCGCACCTTTAGCATGCTGTCCAAGCTCGGCACCGCCGCGGCCCTC
TTCACCTTCATCTCCGTCATCCTCGCCACCGCCTTCGCCGGCGTCCAGGGCCGCCCGGCCGGCTACACCCCGGCC
AAGGGTGACCCCATCGTCACCGCCTTCCCCGTCGCCAGCACCACCTTTGTCCAGGGCATGGCCGCCTTCCTCAAC
ATCAGCTACACCTTTATCGGCCAGATCACCCTACCCAGTTTCATCGCCGAGATGCGCGACCCCAGAGAATTTCCC
AAGTCGCTGTGGGCGTGCACCATTGCCGAAATCATCACGTTCAGCGTCGTCGGCGCCGTCATCTACGCCTACACC
GGCAACCAGTACGTCAAGGCCCCGGCCTTTGGCTCCCTCGAAGACGTGTACAAAAAGGTGTCCTTCTCCTTCATG
ATCCCGACCATCATCTTCCTCGGCTGCCTGTACGCGTCCGTCACGGCCCGCTTCGTCTTCTTCCGCATCTTCCGC
AACTCGCGCCATCTCAACGACCACACCCTTGTCGGCTGGGGCTCATGGGGCGGCATTCTGCTCGTCACCTGGCTG
CTGGCCTTTCTCATCTCGCAGCTCATCCCCTTCTTCTCGTCCCTGCTGTCCGTCATGTCGTCGCTCTTCGACAGC
TGGTTCGGCTTCATCTTCTGGGGCGTCGCCTACTTCCGCATGCGCCGCGCGGACCGAAAGGTCGGCCGGTGCCGA
ACCCCCCTGCTGGACTACCTGTCGATGGCGCTCAACGTCGTCATCATTCTGACCGGCGTCTTCTTCCTCACCGCC
GGCACGTACGCCAGCGTGCAGGGCATCGTCGACGCCTTCAACGCGGGCGAGGTCGGCGGAGTCTTTTCCTGCAAA
AGTAACGCCGTATGA
Gene >Hirsu2|7902
ATGGCCGCCAAGTCGGAACCGCTCAAGTCGGGGCTCGCGTCCCGCTCCGGGTCGGACGAGCTCATCGCCGCGACC
CGTGACGCCGAGTATGCGTCGGACAAAGGCAAGACGCAGATCCTGGCGTCCTTGTTCGGCGGCAAGGCCGTGGCC
ATCGGCCCGCGCATCGCGCCGCTGCCCGACTGGCTCAAGAACGACGTGGGCATGGCCGACGACAGCGGCGAGGAC
CTGAGCAGCGCCGCCATCCTCGACCGCCAGCTCGACTCGGAGAACGGGCACTCGATCCAGTACCGCACGTGCAGC
TGGCAGAAGACGGCGGCGCTGCTGTTCAGCGAGTACATCTGCCTGGCCATCATGAGCTTTCCCTGGTCCTACAGC
TTCCTCGGCCTGGTGCCCGGCCTGATCCTGACGGCCGTCGTCGCCGTCGTCGTCCTCTACACCAGCCTCGTCCTG
TGGGAGTTCTGCCTGCGCCATCCCGAGGTCCGCGACGTCTGCGACCTCGGCCAGATGCTCTTCTGGGGCCGGCCC
TGGGCCTGGTGGGGCACCGCCCTCATGTTCGTCCTGAACAACACCTTCATCCAGGGCCTGCACGTCCTCGTCGGC
GCCGAGTACCTCAACACCATGACGGCCGCCGACCACATCGCCGGCTGCCGCACCGTCCAGTTCTCCATCGCCCTC
ACCTTCATCTGCTGGCTGGCCTCGCTGCCGCGCACCTTTAGCATGCTGTCCAAGCTCGGCACCGCCGCGGCCCTC
TTCACCTTCATCTCCGTCATCCTCGCCACCGCCTTCGCCGGCGTCCAGGGCCGCCCGGCCGGCTACACCCCGGCC
AAGGGTGACCCCATCGTCACCGCCTTCCCCGTCGCCAGCACCACCTTTGTCCAGGGCATGGCCGCCTTCCTCAAC
ATCAGCTACACCTTTATCGGCCAGATCACCCTACCCAGTTTCATCGCCGAGATGCGCGACCCCAGGTGAGTCTCT
CTCTCCCTTTCCCTACTTGCGGCTCCCGACCCGAACCCCTACTGACGGGCGTTTGTTTTCTGCTCTTTCACAGAG
AATTTCCCAAGTCGCTGTGGGCGTGCACCATTGCCGAAATCATCACGTTCAGCGTCGTCGGCGCCGTCATCTACG
CCTACACCGGCAACCAGTACGTCAAGGCCCCGGCCTTTGGCTCCCTCGAAGACGTGTACAAAAAGGTGTCCTTCT
CCTTCATGATCCCGACCATCATCTTCCTCGGCTGCCTGTACGCGTCCGTCACGGCCCGCTTCGTCTTCTTCCGCA
TCTTCCGCAACTCGCGCCATCTCAACGACCACACCCTTGTCGGCTGGGGCTCATGGGGCGGCATTCTGCTCGTCA
CCTGGCTGCTGGCCTTTCTCATCTCGCAGCTCATCCCCTTCTTCTCGTCCCGTGAGTAGCACTTCCCTCTCGGCT
CTCGTCGTTGCCCGAAATGCTGACACGGTCTGCGCCCGCCAGTGCTGTCCGTCATGTCGTCGCTCTTCGACAGCT
GGTTCGGCTTCATCTTCTGGGGCGTCGCCTACTTCCGCATGCGCCGCGCGGACCGAAAGGTCGGCCGGTGCCGAA
CCCCCCTGCTGGACTACCTGTCGATGGCGCTCAACGTCGTCATCATTCTGACCGGCGTCTTCTTCCTCACCGCCG
GCACGTACGCCAGCGTGCAGGGCATCGTCGACGCCTTCAACGCGGGCGAGGTCGGCGGAGTCTTTTCCTGCAAAA
GTAACGCCGTATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail