Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7897
Gene name
LocationContig_487:17400..18309
Strand-
Gene length (bp)909
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00120 Gln-synt_C Glutamine synthetase, catalytic domain 4.6E-41 5 288

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38094|FLUG_EMENI Protein fluG OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fluG PE=1 SV=1 48 302 8.0E-47
sp|Q86B00|GLNA1_DICDI Type-1 glutamine synthetase 1 OS=Dictyostelium discoideum GN=glnA1 PE=3 SV=1 48 302 1.0E-21
sp|O58097|GLNA_PYRHO Glutamine synthetase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=glnA PE=3 SV=1 4 282 8.0E-21
sp|Q9UY99|GLNA_PYRAB Glutamine synthetase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=glnA PE=3 SV=1 7 282 8.0E-20
sp|Q60182|GLNA_METJA Glutamine synthetase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=glnA PE=3 SV=1 54 298 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38094|FLUG_EMENI Protein fluG OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fluG PE=1 SV=1 48 302 8.0E-47
sp|Q86B00|GLNA1_DICDI Type-1 glutamine synthetase 1 OS=Dictyostelium discoideum GN=glnA1 PE=3 SV=1 48 302 1.0E-21
sp|O58097|GLNA_PYRHO Glutamine synthetase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=glnA PE=3 SV=1 4 282 8.0E-21
sp|Q9UY99|GLNA_PYRAB Glutamine synthetase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=glnA PE=3 SV=1 7 282 8.0E-20
sp|Q60182|GLNA_METJA Glutamine synthetase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=glnA PE=3 SV=1 54 298 1.0E-19
sp|P10656|GLNA_CLOSA Glutamine synthetase OS=Clostridium saccharobutylicum GN=glnA PE=3 SV=1 8 300 1.0E-19
sp|P43386|GLNA_HALVD Glutamine synthetase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=glnA PE=3 SV=2 4 282 2.0E-19
sp|A9ZPH9|GMAS_METMY Glutamate--methylamine ligase OS=Methylovorus mays PE=1 SV=1 6 298 2.0E-19
sp|O59648|GLNA_METMP Glutamine synthetase OS=Methanococcus maripaludis (strain S2 / LL) GN=glnA PE=3 SV=1 5 298 2.0E-19
sp|O27612|GLNA_METTH Glutamine synthetase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=glnA PE=3 SV=1 8 301 5.0E-19
sp|Q05907|GLNA_PYRFU Glutamine synthetase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=glnA PE=3 SV=2 7 282 1.0E-18
sp|P36687|GLNA_PYRWO Glutamine synthetase 1 OS=Pyrococcus woesei GN=glnA PE=3 SV=1 7 282 2.0E-18
sp|F5RH07|GMAS_METUF Glutamate--methylamine ligase OS=Methyloversatilis universalis (strain ATCC BAA-1314 / JCM 13912 / FAM5) GN=gms PE=1 SV=1 6 298 3.0E-18
sp|Q9HNI2|GLNA_HALSA Glutamine synthetase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=glnA PE=3 SV=1 8 288 2.0E-17
sp|O08467|GLNA_THEKO Glutamine synthetase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=glnA PE=1 SV=2 8 282 2.0E-17
sp|P99095|GLNA_STAAN Glutamine synthetase OS=Staphylococcus aureus (strain N315) GN=glnA PE=1 SV=1 55 282 4.0E-17
sp|P60890|GLNA_STAAM Glutamine synthetase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glnA PE=3 SV=1 55 282 4.0E-17
sp|P0A039|GLNA_STAAW Glutamine synthetase OS=Staphylococcus aureus (strain MW2) GN=glnA PE=3 SV=1 55 282 5.0E-17
sp|P0A040|GLNA_STAAU Glutamine synthetase OS=Staphylococcus aureus GN=glnA PE=3 SV=1 55 282 5.0E-17
sp|Q6G9Q4|GLNA_STAAS Glutamine synthetase OS=Staphylococcus aureus (strain MSSA476) GN=glnA PE=3 SV=1 55 282 5.0E-17
sp|Q5HGC3|GLNA_STAAC Glutamine synthetase OS=Staphylococcus aureus (strain COL) GN=glnA PE=3 SV=1 55 282 5.0E-17
sp|O29313|GLNA_ARCFU Glutamine synthetase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=glnA PE=3 SV=1 42 282 5.0E-17
sp|Q8CSR8|GLNA_STAES Glutamine synthetase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glnA PE=3 SV=1 55 282 9.0E-17
sp|Q5HPN2|GLNA_STAEQ Glutamine synthetase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glnA PE=3 SV=1 55 282 9.0E-17
sp|Q6GHC6|GLNA_STAAR Glutamine synthetase OS=Staphylococcus aureus (strain MRSA252) GN=glnA PE=3 SV=1 55 282 1.0E-16
sp|P19064|GLNA_BACCE Glutamine synthetase OS=Bacillus cereus GN=glnA PE=1 SV=3 5 220 6.0E-16
sp|P45627|GLNA_LACDE Glutamine synthetase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=glnA PE=3 SV=1 5 282 1.0E-15
sp|P12425|GLNA_BACSU Glutamine synthetase OS=Bacillus subtilis (strain 168) GN=glnA PE=1 SV=3 55 220 2.0E-15
sp|P15124|GLNA_METCA Glutamine synthetase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=glnA PE=3 SV=2 44 287 3.0E-15
sp|P00964|GLNA_NOSS1 Glutamine synthetase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=glnA PE=1 SV=3 44 285 3.0E-15
sp|P28605|GLNA_SYNP2 Glutamine synthetase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=glnA PE=3 SV=2 50 287 8.0E-15
sp|P9WN39|GLNA1_MYCTU Glutamine synthetase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glnA1 PE=1 SV=1 49 280 8.0E-15
sp|P9WN38|GLNA1_MYCTO Glutamine synthetase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glnA1 PE=3 SV=1 49 280 8.0E-15
sp|P0A591|GLNA1_MYCBO Glutamine synthetase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glnA1 PE=3 SV=1 49 280 8.0E-15
sp|Q59747|GLNA1_RHIME Glutamine synthetase 1 OS=Rhizobium meliloti (strain 1021) GN=glnA PE=3 SV=2 42 286 1.0E-14
sp|Q936T0|IPUC_PSESP Glutamate--isopropylamine ligase OS=Pseudomonas sp. GN=ipuC PE=1 SV=1 50 252 2.0E-14
sp|P36205|GLNA_THEMA Glutamine synthetase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glnA PE=3 SV=2 46 220 6.0E-14
sp|Q9HH09|GLNA_SULAC Glutamine synthetase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=glnA PE=1 SV=2 59 283 8.0E-14
sp|A0R083|GLNA2_MYCS2 Probable glutamine synthetase 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glnA PE=1 SV=1 11 288 9.0E-14
sp|A0R079|GLNA1_MYCS2 Glutamine synthetase 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glnA PE=1 SV=1 55 280 1.0E-13
sp|P46033|GLNA1_FRAAL Glutamine synthetase 1 OS=Frankia alni GN=glnA PE=3 SV=1 50 287 1.0E-13
sp|P9WN37|GLNA2_MYCTU Probable glutamine synthetase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glnA2 PE=1 SV=1 50 299 1.0E-13
sp|P9WN36|GLNA2_MYCTO Probable glutamine synthetase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glnA2 PE=3 SV=1 50 299 1.0E-13
sp|P64246|GLNA2_MYCBO Probable glutamine synthetase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glnA2 PE=3 SV=1 50 299 1.0E-13
sp|P31592|GLNA3_RHILP Glutamine synthetase 3 OS=Rhizobium leguminosarum bv. phaseoli GN=glnT PE=1 SV=1 6 282 1.0E-13
sp|O66514|GLNA_AQUAE Glutamine synthetase OS=Aquifex aeolicus (strain VF5) GN=glnA PE=3 SV=1 21 287 2.0E-13
sp|P15106|GLNA_STRCO Glutamine synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glnA PE=2 SV=1 45 282 3.0E-13
sp|P94126|GLNA_AZOC5 Glutamine synthetase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=glnA PE=3 SV=2 50 282 3.0E-13
sp|P33035|GLNA_MICDP Glutamine synthetase OS=Microchaete diplosiphon GN=glnA PE=3 SV=2 50 285 3.0E-13
sp|P21154|GLNA_METVO Glutamine synthetase OS=Methanococcus voltae GN=glnA PE=3 SV=1 54 292 6.0E-13
sp|P77958|GLNA1_STRFL Glutamine synthetase 1 OS=Streptomyces filamentosus GN=glnA PE=3 SV=1 55 282 7.0E-13
sp|O87393|GLNA3_RHIME Glutamine synthetase 3 OS=Rhizobium meliloti (strain 1021) GN=glnT PE=1 SV=1 48 282 1.0E-12
sp|P94845|GLNA_HELPY Glutamine synthetase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=glnA PE=3 SV=2 50 220 1.0E-12
sp|Q9CDL9|GLNA_LACLA Glutamine synthetase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glnA PE=3 SV=1 50 282 1.0E-12
sp|P22248|GLNA_AZOVI Glutamine synthetase OS=Azotobacter vinelandii GN=glnA PE=3 SV=1 47 289 2.0E-12
sp|Q3V5W6|GLNA_PSETA Glutamine synthetase OS=Pseudomonas taetrolens GN=glnA PE=1 SV=1 47 289 2.0E-12
sp|Q9ZLW5|GLNA_HELPJ Glutamine synthetase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=glnA PE=3 SV=1 50 220 4.0E-12
sp|P77961|GLNA_SYNY3 Glutamine synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glnA PE=1 SV=2 60 258 4.0E-12
sp|Q9HU65|GLNA_PSEAE Glutamine synthetase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glnA PE=1 SV=1 47 289 6.0E-12
sp|P10583|GLNA_AZOBR Glutamine synthetase OS=Azospirillum brasilense GN=glnA PE=3 SV=1 50 289 6.0E-12
sp|Q05542|GLNA1_STRVR Glutamine synthetase 1 OS=Streptomyces viridochromogenes GN=glnI PE=3 SV=1 66 256 8.0E-12
sp|P09826|GLNA1_RHILV Glutamine synthetase 1 OS=Rhizobium leguminosarum bv. viciae GN=glnA PE=3 SV=1 50 286 2.0E-11
sp|Q46ZL2|3HAPM_CUPPJ 3-hydroxylaminophenol mutase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=Reut_A2057 PE=1 SV=1 44 287 5.0E-11
sp|P23794|GLNA_SULSO Glutamine synthetase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=glnA PE=3 SV=2 59 289 5.0E-11
sp|P19904|GLNA_VIBAL Glutamine synthetase OS=Vibrio alginolyticus GN=glnA PE=3 SV=1 57 282 6.0E-11
sp|P43518|GLNA_RHOSH Glutamine synthetase OS=Rhodobacter sphaeroides GN=glnA PE=3 SV=1 50 284 1.0E-10
sp|P20805|GLNA2_FRAAL Glutamine synthetase 2 OS=Frankia alni GN=glnII PE=2 SV=1 7 235 1.0E-10
sp|P05457|GLNA1_BRADU Glutamine synthetase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glnA PE=3 SV=2 50 282 1.0E-10
sp|Q9CLP2|GLNA_PASMU Glutamine synthetase OS=Pasteurella multocida (strain Pm70) GN=glnA PE=3 SV=1 55 287 1.0E-10
sp|P07804|GLNA_ACIFR Glutamine synthetase OS=Acidithiobacillus ferrooxidans GN=glnA PE=3 SV=1 54 287 1.0E-10
sp|P43794|GLNA_HAEIN Glutamine synthetase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glnA PE=3 SV=1 55 287 2.0E-10
sp|Q9KNJ2|GLNA_VIBCH Glutamine synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glnA PE=3 SV=1 57 282 3.0E-10
sp|P28786|GLNA_PROHU Glutamine synthetase OS=Proteus hauseri GN=glnA PE=3 SV=1 57 287 3.0E-10
sp|P25821|GLNA_NEIGO Glutamine synthetase OS=Neisseria gonorrhoeae GN=glnA PE=3 SV=1 51 287 2.0E-09
sp|P08282|GLNA1_PEA Glutamine synthetase nodule isozyme OS=Pisum sativum GN=GS1 PE=2 SV=2 5 185 2.0E-09
sp|P13499|GLNA_RHOCA Glutamine synthetase (Fragment) OS=Rhodobacter capsulatus GN=glnA PE=3 SV=2 50 256 2.0E-09
sp|Q8LCE1|GLN12_ARATH Glutamine synthetase cytosolic isozyme 1-2 OS=Arabidopsis thaliana GN=GLN1-2 PE=1 SV=2 7 129 5.0E-09
sp|P0C7B6|GLNA2_DICDI Type-1 glutamine synthetase 2 OS=Dictyostelium discoideum GN=glnA2 PE=1 SV=1 3 284 1.0E-08
sp|P23712|GLNA_LACSA Glutamine synthetase OS=Lactuca sativa PE=2 SV=2 7 129 2.0E-08
sp|O22506|GLNA2_DAUCA Glutamine synthetase, chloroplastic OS=Daucus carota GN=GLN2 PE=2 SV=1 9 185 3.0E-08
sp|P38559|GLNA1_MAIZE Glutamine synthetase root isozyme 1 OS=Zea mays GN=GLN6 PE=2 SV=1 7 129 4.0E-08
sp|P38560|GLNA2_MAIZE Glutamine synthetase root isozyme 2 OS=Zea mays GN=GLN2 PE=2 SV=1 9 129 4.0E-08
sp|P14636|GLNA3_LUPAN Glutamine synthetase nodule isozyme (Fragment) OS=Lupinus angustifolius PE=2 SV=1 27 129 4.0E-08
sp|P52782|GLNA_LUPLU Glutamine synthetase nodule isozyme OS=Lupinus luteus PE=3 SV=1 27 129 4.0E-08
sp|P14656|GLN11_ORYSJ Glutamine synthetase cytosolic isozyme 1-1 OS=Oryza sativa subsp. japonica GN=GLN1-1 PE=1 SV=1 7 129 4.0E-08
sp|P14654|GLN12_ORYSJ Glutamine synthetase cytosolic isozyme 1-2 OS=Oryza sativa subsp. japonica GN=GLN1-2 PE=1 SV=1 9 129 4.0E-08
sp|Q5UR44|GLNA_MIMIV Putative glutamine synthetase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R565 PE=3 SV=1 9 129 5.0E-08
sp|P12424|GLNA_NICPL Glutamine synthetase OS=Nicotiana plumbaginifolia PE=2 SV=1 7 129 5.0E-08
sp|P22878|GLNA2_STRHY Glutamine synthetase 2 OS=Streptomyces hygroscopicus GN=glnB PE=3 SV=1 7 130 5.0E-08
sp|O22504|GLNA1_DAUCA Glutamine synthetase cytosolic isozyme OS=Daucus carota GN=GLN1 PE=2 SV=1 27 129 5.0E-08
sp|P38563|GLNA5_MAIZE Glutamine synthetase root isozyme 5 OS=Zea mays GN=GS1-5 PE=2 SV=2 7 129 6.0E-08
sp|Q56WN1|GLN11_ARATH Glutamine synthetase cytosolic isozyme 1-1 OS=Arabidopsis thaliana GN=GLN1-1 PE=1 SV=2 7 129 6.0E-08
sp|Q06378|GLNA3_HORVU Glutamine synthetase OS=Hordeum vulgare PE=2 SV=1 1 129 7.0E-08
sp|Q43785|GLNA3_MEDSA Glutamine synthetase nodule isozyme OS=Medicago sativa GN=GS1 PE=2 SV=1 7 129 1.0E-07
sp|P38561|GLNA3_MAIZE Glutamine synthetase root isozyme 3 OS=Zea mays GN=GLN4 PE=1 SV=1 7 129 1.0E-07
sp|P38562|GLNA4_MAIZE Glutamine synthetase root isozyme 4 OS=Zea mays GN=GLN5 PE=2 SV=1 7 129 1.0E-07
sp|Q4W8D0|GLN13_ORYSJ Glutamine synthetase cytosolic isozyme 1-3 OS=Oryza sativa subsp. japonica GN=GLN1-3 PE=2 SV=1 33 129 1.0E-07
sp|Q43066|GLNA4_PEA Glutamine synthetase root isozyme B OS=Pisum sativum GN=GS3B PE=3 SV=1 7 129 1.0E-07
sp|P09606|GLNA_RAT Glutamine synthetase OS=Rattus norvegicus GN=Glul PE=1 SV=3 27 228 2.0E-07
sp|P04078|GLNA1_MEDSA Glutamine synthetase cytosolic isozyme OS=Medicago sativa PE=2 SV=1 7 129 2.0E-07
sp|Q4R7U3|GLNA_MACFA Glutamine synthetase OS=Macaca fascicularis GN=GLUL PE=2 SV=3 27 228 2.0E-07
sp|P32289|GLNA_VIGAC Glutamine synthetase nodule isozyme OS=Vigna aconitifolia PE=2 SV=1 7 129 2.0E-07
sp|P07694|GLNA3_PEA Glutamine synthetase root isozyme A OS=Pisum sativum GN=GS3A PE=2 SV=1 7 185 2.0E-07
sp|P15104|GLNA_HUMAN Glutamine synthetase OS=Homo sapiens GN=GLUL PE=1 SV=4 27 228 2.0E-07
sp|P00965|GLNA3_PHAVU Glutamine synthetase N-1 OS=Phaseolus vulgaris GN=Gln-gamma PE=2 SV=2 27 129 2.0E-07
sp|P14655|GLNA2_ORYSJ Glutamine synthetase, chloroplastic OS=Oryza sativa subsp. japonica GN=GLN2 PE=1 SV=1 9 185 3.0E-07
sp|Q42689|GLNA2_CHLRE Glutamine synthetase, chloroplastic OS=Chlamydomonas reinhardtii GN=GLN2 PE=2 SV=1 5 129 3.0E-07
sp|P15105|GLNA_MOUSE Glutamine synthetase OS=Mus musculus GN=Glul PE=1 SV=6 27 130 3.0E-07
sp|O82560|GLNA2_SOYBN Glutamine synthetase cytosolic isozyme 2 OS=Glycine max PE=1 SV=1 27 185 3.0E-07
sp|P24099|GLNA1_SOYBN Glutamine synthetase cytosolic isozyme 1 OS=Glycine max PE=2 SV=1 7 129 3.0E-07
sp|P25462|GLNAC_MAIZE Glutamine synthetase, chloroplastic OS=Zea mays GN=GLN2 PE=2 SV=1 9 129 3.0E-07
sp|Q9QY94|GLNA_ACOCA Glutamine synthetase OS=Acomys cahirinus GN=GLUL PE=2 SV=3 27 130 4.0E-07
sp|P15103|GLNA_BOVIN Glutamine synthetase OS=Bos taurus GN=GLUL PE=2 SV=4 27 130 4.0E-07
sp|Q8HZM5|GLNA_CANLF Glutamine synthetase OS=Canis lupus familiaris GN=GLUL PE=1 SV=3 27 130 4.0E-07
sp|P19432|GLNA2_STRVR Glutamine synthetase 2 OS=Streptomyces viridochromogenes GN=glnII PE=3 SV=1 7 129 4.0E-07
sp|P46410|GLNA_PIG Glutamine synthetase OS=Sus scrofa GN=GLUL PE=2 SV=3 27 130 5.0E-07
sp|Q9XQ94|GLNA2_MEDSA Glutamine synthetase leaf isozyme, chloroplastic OS=Medicago sativa GN=GS2 PE=2 SV=1 9 129 5.0E-07
sp|Q9FMD9|GLN14_ARATH Glutamine synthetase cytosolic isozyme 1-4 OS=Arabidopsis thaliana GN=GLN1-4 PE=1 SV=1 27 129 5.0E-07
sp|P41320|GLNA_SQUAC Glutamine synthetase, mitochondrial OS=Squalus acanthias PE=2 SV=1 27 130 5.0E-07
sp|Q42624|GLNAC_BRANA Glutamine synthetase, chloroplastic OS=Brassica napus GN=GLN2 PE=2 SV=1 27 129 6.0E-07
sp|P51119|GLNA2_VITVI Glutamine synthetase cytosolic isozyme 2 OS=Vitis vinifera GN=GS1-2 PE=2 SV=1 27 129 6.0E-07
sp|Q6B4U7|GLNA_DEBHA Glutamine synthetase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GLN1 PE=3 SV=1 27 130 1.0E-06
sp|P20478|GLNA2_DROME Glutamine synthetase 2 cytoplasmic OS=Drosophila melanogaster GN=Gs2 PE=2 SV=3 48 129 1.0E-06
sp|Q0GA40|LGSN_RABIT Lengsin OS=Oryctolagus cuniculus GN=LGSN PE=2 SV=1 2 282 2.0E-06
sp|P16580|GLNA_CHICK Glutamine synthetase OS=Gallus gallus GN=GLUL PE=1 SV=1 27 130 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004356 glutamate-ammonia ligase activity Yes
GO:0006807 nitrogen compound metabolic process Yes
GO:0008152 metabolic process No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0016211 ammonia ligase activity No
GO:0003674 molecular_function No
GO:0016880 acid-ammonia (or amide) ligase activity No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7897
LCRLDLLVGFEVEFEVFRADAGGRLVPHSAGLGTSACAGLRDPSFAQVEEAMQALLEAGVGLEVVHAEGARGQYE
FVLGPRPPLEAVDELVLVQDTLKRVFGRHGLVATMFPRPLPARFQSNGQHTHLSIGRPELEQRFLAGLLARLPGL
CAVCMPFDLSYERARPRLAGDVVAWGTEDRSVPVRRIKPGHWEIRPVDATANMYLALAALLSAGLAGCVNDEPLL
LPDTAAEPDPDAPAARGPPLPTSLDEALDRLAEIAPELEAIMQSRVLQNFLGLKRAEAFKLRAMGDDEARCFLTQ
LF*
Coding >Hirsu2|7897
CTGTGCCGCCTCGACCTGCTCGTCGGCTTCGAGGTCGAGTTCGAGGTCTTCCGCGCCGACGCCGGCGGCCGGCTG
GTGCCCCACAGCGCCGGCCTCGGCACCTCGGCCTGCGCCGGCCTGCGCGACCCGAGCTTCGCCCAGGTGGAGGAG
GCGATGCAGGCGCTGCTGGAGGCCGGCGTCGGGCTCGAGGTCGTCCACGCCGAGGGCGCGCGCGGCCAGTACGAG
TTCGTCCTCGGGCCGCGGCCGCCGCTCGAGGCCGTCGACGAGCTGGTCCTGGTCCAGGACACGCTGAAGCGCGTC
TTCGGCCGCCACGGGCTCGTAGCCACCATGTTCCCGCGCCCGCTGCCCGCGCGCTTCCAGTCCAACGGGCAGCAC
ACGCACCTGTCCATCGGCCGGCCGGAGCTGGAGCAGCGCTTCCTGGCCGGCCTACTGGCCCGGCTGCCCGGCCTG
TGCGCCGTCTGCATGCCCTTCGACCTGTCGTACGAGCGCGCCCGGCCGCGGCTGGCCGGCGACGTCGTCGCCTGG
GGCACCGAGGACCGGAGCGTGCCGGTGCGCCGCATCAAGCCCGGCCACTGGGAGATCCGCCCGGTCGACGCCACC
GCCAACATGTATCTCGCCCTGGCCGCCCTCCTGAGCGCCGGTCTGGCCGGCTGCGTCAACGACGAGCCTCTGCTG
CTGCCGGACACGGCCGCCGAGCCCGACCCCGACGCCCCGGCCGCCCGCGGGCCGCCCCTGCCGACGAGCCTCGAC
GAGGCCCTCGACCGCCTGGCCGAGATCGCGCCCGAGCTCGAAGCCATAATGCAGAGCCGGGTCCTGCAGAACTTC
CTGGGCCTGAAGAGGGCCGAAGCCTTCAAACTGCGCGCCATGGGCGACGACGAGGCCCGTTGCTTCCTCACTCAG
CTCTTCTGA
Transcript >Hirsu2|7897
CTGTGCCGCCTCGACCTGCTCGTCGGCTTCGAGGTCGAGTTCGAGGTCTTCCGCGCCGACGCCGGCGGCCGGCTG
GTGCCCCACAGCGCCGGCCTCGGCACCTCGGCCTGCGCCGGCCTGCGCGACCCGAGCTTCGCCCAGGTGGAGGAG
GCGATGCAGGCGCTGCTGGAGGCCGGCGTCGGGCTCGAGGTCGTCCACGCCGAGGGCGCGCGCGGCCAGTACGAG
TTCGTCCTCGGGCCGCGGCCGCCGCTCGAGGCCGTCGACGAGCTGGTCCTGGTCCAGGACACGCTGAAGCGCGTC
TTCGGCCGCCACGGGCTCGTAGCCACCATGTTCCCGCGCCCGCTGCCCGCGCGCTTCCAGTCCAACGGGCAGCAC
ACGCACCTGTCCATCGGCCGGCCGGAGCTGGAGCAGCGCTTCCTGGCCGGCCTACTGGCCCGGCTGCCCGGCCTG
TGCGCCGTCTGCATGCCCTTCGACCTGTCGTACGAGCGCGCCCGGCCGCGGCTGGCCGGCGACGTCGTCGCCTGG
GGCACCGAGGACCGGAGCGTGCCGGTGCGCCGCATCAAGCCCGGCCACTGGGAGATCCGCCCGGTCGACGCCACC
GCCAACATGTATCTCGCCCTGGCCGCCCTCCTGAGCGCCGGTCTGGCCGGCTGCGTCAACGACGAGCCTCTGCTG
CTGCCGGACACGGCCGCCGAGCCCGACCCCGACGCCCCGGCCGCCCGCGGGCCGCCCCTGCCGACGAGCCTCGAC
GAGGCCCTCGACCGCCTGGCCGAGATCGCGCCCGAGCTCGAAGCCATAATGCAGAGCCGGGTCCTGCAGAACTTC
CTGGGCCTGAAGAGGGCCGAAGCCTTCAAACTGCGCGCCATGGGCGACGACGAGGCCCGTTGCTTCCTCACTCAG
CTCTTCTGA
Gene >Hirsu2|7897
CTGTGCCGCCTCGACCTGCTCGTCGGCTTCGAGGTCGAGTTCGAGGTCTTCCGCGCCGACGCCGGCGGCCGGCTG
GTGCCCCACAGCGCCGGCCTCGGCACCTCGGCCTGCGCCGGCCTGCGCGACCCGAGCTTCGCCCAGGTGGAGGAG
GCGATGCAGGCGCTGCTGGAGGCCGGCGTCGGGCTCGAGGTCGTCCACGCCGAGGGCGCGCGCGGCCAGTACGAG
TTCGTCCTCGGGCCGCGGCCGCCGCTCGAGGCCGTCGACGAGCTGGTCCTGGTCCAGGACACGCTGAAGCGCGTC
TTCGGCCGCCACGGGCTCGTAGCCACCATGTTCCCGCGCCCGCTGCCCGCGCGCTTCCAGTCCAACGGGCAGCAC
ACGCACCTGTCCATCGGCCGGCCGGAGCTGGAGCAGCGCTTCCTGGCCGGCCTACTGGCCCGGCTGCCCGGCCTG
TGCGCCGTCTGCATGCCCTTCGACCTGTCGTACGAGCGCGCCCGGCCGCGGCTGGCCGGCGACGTCGTCGCCTGG
GGCACCGAGGACCGGAGCGTGCCGGTGCGCCGCATCAAGCCCGGCCACTGGGAGATCCGCCCGGTCGACGCCACC
GCCAACATGTATCTCGCCCTGGCCGCCCTCCTGAGCGCCGGTCTGGCCGGCTGCGTCAACGACGAGCCTCTGCTG
CTGCCGGACACGGCCGCCGAGCCCGACCCCGACGCCCCGGCCGCCCGCGGGCCGCCCCTGCCGACGAGCCTCGAC
GAGGCCCTCGACCGCCTGGCCGAGATCGCGCCCGAGCTCGAAGCCATAATGCAGAGCCGGGTCCTGCAGAACTTC
CTGGGCCTGAAGAGGGCCGAAGCCTTCAAACTGCGCGCCATGGGCGACGACGAGGCCCGTTGCTTCCTCACTCAG
CTCTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail