Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7896
Gene name
LocationContig_487:10205..12094
Strand-
Gene length (bp)1889
Transcript length (bp)1800
Coding sequence length (bp)1800
Protein length (aa) 600

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 3.9E-24 126 274
PF08031 BBE Berberine and berberine like 8.4E-07 540 580

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 1 586 4.0E-57
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 31 586 6.0E-57
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 123 335 6.0E-15
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 125 304 3.0E-07
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 249 310 2.0E-06

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7896
MRHQLSWTLASALLAAAAAQANGQQASPKCRCVPGESCWPSEDKWLSFGAKLKGKLVKSEPVAISCYEGPLKDLA
KCNEVWNQWSADSFQTKQPLGRYYPYTQSCPPVDYAQGEAPKTCSLGQLPVYVVEAVDRSDIAEALRFTREHNIR
VTVTNTGHDLNGRSDGFGSLTIWLQKFRKGISFQPRLQSATGCAASNWSGSALRLDGAYRWRDVVKVAKEKKVMV
VSGGSGSPGASGGWMLGGGHGPASREYGLGADQLLEAEVMLANGSVVTANHCQHPDLFRSLRGGGPGYGVVLGVT
IKAYLMPDTWSMTVHQLDLWPETQTDSNSELLDAVAHLAQSFPQLNDAGFSGYGVWFRNLRGEFMGGRRSGYNHK
LWIVGKNKTEAWSLFEPVRASLDTLKGAVVLNETLREYRNFWTFFDTELGHDDVSGLSLYTTSRFLDKPAVADLR
KLREAVDVVSGRPEEYTMNILALGSGGKVFEDAADTSSGLHPAWRTAPMFLITGRRAAHSATEAERRAVMDDITR
VKGAATKSLAPDTGAYMNEGDRNDPDWKQAFYGSNYGHHLATKHAYDPDKVFYCPTCVGSDEFVSREDGALCLA*
Coding >Hirsu2|7896
ATGCGCCACCAGCTCTCCTGGACGCTGGCTTCGGCCTTGCTGGCGGCGGCCGCTGCTCAAGCAAACGGCCAGCAG
GCCTCGCCCAAGTGCAGATGCGTCCCCGGTGAGAGTTGTTGGCCATCCGAGGACAAGTGGCTCAGCTTCGGCGCC
AAACTCAAGGGCAAGCTCGTCAAGTCGGAGCCCGTGGCCATCTCGTGCTATGAAGGCCCGCTCAAGGATCTCGCA
AAGTGCAACGAGGTCTGGAACCAGTGGTCGGCGGACAGCTTCCAGACCAAGCAACCGCTCGGGAGGTATTACCCT
TATACCCAGTCCTGTCCACCCGTCGACTACGCCCAAGGCGAGGCGCCCAAAACGTGCTCGCTCGGGCAGCTGCCC
GTCTACGTCGTCGAGGCCGTCGATCGGTCGGACATCGCCGAGGCCCTCCGGTTCACGCGGGAGCACAACATCCGC
GTCACCGTCACCAACACGGGCCACGACCTCAACGGCCGCTCCGACGGCTTCGGGAGCCTGACCATCTGGCTGCAG
AAGTTCCGCAAGGGCATCAGCTTCCAGCCCCGGCTGCAGTCCGCCACCGGATGCGCCGCCTCCAACTGGAGCGGC
AGCGCCCTGCGTCTCGACGGCGCCTATCGCTGGCGGGACGTCGTCAAGGTGGCCAAGGAGAAGAAGGTGATGGTC
GTCAGCGGCGGCTCGGGCTCGCCCGGGGCCAGCGGCGGCTGGATGCTGGGCGGCGGCCACGGGCCGGCCTCGCGC
GAGTACGGGCTCGGCGCCGACCAGCTTCTCGAGGCCGAGGTGATGCTCGCCAACGGCTCCGTCGTCACCGCCAAC
CACTGCCAGCACCCGGACCTGTTCCGCTCCCTGCGCGGCGGCGGCCCGGGCTACGGCGTCGTGCTCGGCGTCACC
ATCAAGGCCTATCTGATGCCCGACACGTGGAGCATGACGGTCCACCAGCTGGACCTCTGGCCCGAGACGCAGACG
GACAGCAACTCGGAGCTCCTCGACGCCGTGGCCCACCTGGCTCAGTCGTTCCCGCAGCTCAACGACGCCGGCTTC
TCCGGGTACGGCGTCTGGTTCCGGAACCTGCGGGGCGAGTTTATGGGCGGCCGCCGCTCCGGCTACAACCACAAG
CTCTGGATCGTGGGCAAGAACAAGACCGAGGCCTGGAGCCTGTTCGAGCCGGTGCGGGCCAGTCTCGACACCCTG
AAAGGTGCCGTCGTCCTCAACGAGACGCTGCGCGAGTATCGCAACTTCTGGACCTTCTTCGACACGGAGCTGGGC
CACGACGACGTCTCCGGCTTGTCCCTCTACACCACCTCGCGCTTCCTGGACAAGCCGGCCGTCGCCGACTTACGC
AAGCTCCGCGAGGCCGTCGACGTCGTGAGCGGCCGGCCCGAGGAGTACACCATGAACATCCTGGCGCTCGGCTCC
GGCGGCAAGGTGTTCGAGGACGCGGCCGACACGTCGTCGGGCCTCCATCCGGCTTGGCGCACCGCCCCGATGTTC
CTCATCACCGGCCGCCGGGCCGCCCACTCGGCCACCGAGGCCGAGCGCCGGGCCGTCATGGACGACATCACTCGC
GTCAAGGGCGCCGCCACCAAGAGCCTCGCCCCCGACACGGGCGCCTACATGAACGAGGGCGACCGCAACGACCCG
GACTGGAAGCAGGCCTTCTACGGGTCAAACTACGGCCACCACCTGGCGACCAAGCACGCCTACGACCCGGACAAG
GTCTTCTACTGTCCGACCTGCGTCGGATCCGACGAGTTTGTCAGCCGCGAGGACGGAGCCCTGTGTCTGGCCTAG
Transcript >Hirsu2|7896
ATGCGCCACCAGCTCTCCTGGACGCTGGCTTCGGCCTTGCTGGCGGCGGCCGCTGCTCAAGCAAACGGCCAGCAG
GCCTCGCCCAAGTGCAGATGCGTCCCCGGTGAGAGTTGTTGGCCATCCGAGGACAAGTGGCTCAGCTTCGGCGCC
AAACTCAAGGGCAAGCTCGTCAAGTCGGAGCCCGTGGCCATCTCGTGCTATGAAGGCCCGCTCAAGGATCTCGCA
AAGTGCAACGAGGTCTGGAACCAGTGGTCGGCGGACAGCTTCCAGACCAAGCAACCGCTCGGGAGGTATTACCCT
TATACCCAGTCCTGTCCACCCGTCGACTACGCCCAAGGCGAGGCGCCCAAAACGTGCTCGCTCGGGCAGCTGCCC
GTCTACGTCGTCGAGGCCGTCGATCGGTCGGACATCGCCGAGGCCCTCCGGTTCACGCGGGAGCACAACATCCGC
GTCACCGTCACCAACACGGGCCACGACCTCAACGGCCGCTCCGACGGCTTCGGGAGCCTGACCATCTGGCTGCAG
AAGTTCCGCAAGGGCATCAGCTTCCAGCCCCGGCTGCAGTCCGCCACCGGATGCGCCGCCTCCAACTGGAGCGGC
AGCGCCCTGCGTCTCGACGGCGCCTATCGCTGGCGGGACGTCGTCAAGGTGGCCAAGGAGAAGAAGGTGATGGTC
GTCAGCGGCGGCTCGGGCTCGCCCGGGGCCAGCGGCGGCTGGATGCTGGGCGGCGGCCACGGGCCGGCCTCGCGC
GAGTACGGGCTCGGCGCCGACCAGCTTCTCGAGGCCGAGGTGATGCTCGCCAACGGCTCCGTCGTCACCGCCAAC
CACTGCCAGCACCCGGACCTGTTCCGCTCCCTGCGCGGCGGCGGCCCGGGCTACGGCGTCGTGCTCGGCGTCACC
ATCAAGGCCTATCTGATGCCCGACACGTGGAGCATGACGGTCCACCAGCTGGACCTCTGGCCCGAGACGCAGACG
GACAGCAACTCGGAGCTCCTCGACGCCGTGGCCCACCTGGCTCAGTCGTTCCCGCAGCTCAACGACGCCGGCTTC
TCCGGGTACGGCGTCTGGTTCCGGAACCTGCGGGGCGAGTTTATGGGCGGCCGCCGCTCCGGCTACAACCACAAG
CTCTGGATCGTGGGCAAGAACAAGACCGAGGCCTGGAGCCTGTTCGAGCCGGTGCGGGCCAGTCTCGACACCCTG
AAAGGTGCCGTCGTCCTCAACGAGACGCTGCGCGAGTATCGCAACTTCTGGACCTTCTTCGACACGGAGCTGGGC
CACGACGACGTCTCCGGCTTGTCCCTCTACACCACCTCGCGCTTCCTGGACAAGCCGGCCGTCGCCGACTTACGC
AAGCTCCGCGAGGCCGTCGACGTCGTGAGCGGCCGGCCCGAGGAGTACACCATGAACATCCTGGCGCTCGGCTCC
GGCGGCAAGGTGTTCGAGGACGCGGCCGACACGTCGTCGGGCCTCCATCCGGCTTGGCGCACCGCCCCGATGTTC
CTCATCACCGGCCGCCGGGCCGCCCACTCGGCCACCGAGGCCGAGCGCCGGGCCGTCATGGACGACATCACTCGC
GTCAAGGGCGCCGCCACCAAGAGCCTCGCCCCCGACACGGGCGCCTACATGAACGAGGGCGACCGCAACGACCCG
GACTGGAAGCAGGCCTTCTACGGGTCAAACTACGGCCACCACCTGGCGACCAAGCACGCCTACGACCCGGACAAG
GTCTTCTACTGTCCGACCTGCGTCGGATCCGACGAGTTTGTCAGCCGCGAGGACGGAGCCCTGTGTCTGGCCTAG
Gene >Hirsu2|7896
ATGCGCCACCAGCTCTCCTGGACGCTGGCTTCGGCCTTGCTGGCGGCGGCCGCTGCTCAAGCAAACGGCCAGCAG
GCCTCGCCCAAGTGCAGATGCGTGAGTCGAGCCTCGGTGCCATGGCGGCAAGAAGCACACAGGCTTGCGCAGCGG
CTGATTCGTACGCGCCTGGTGCATCATGCCTTCAGGTCCCCGGTGAGAGTTGTTGGCCATCCGAGGACAAGTGGC
TCAGCTTCGGCGCCAAACTCAAGGGCAAGCTCGTCAAGTCGGAGCCCGTGGCCATCTCGTGCTATGAAGGCCCGC
TCAAGGATCTCGCAAAGTGCAACGAGGTCTGGAACCAGTGGTCGGCGGACAGCTTCCAGACCAAGCAACCGCTCG
GGAGGTATTACCCTTATACCCAGTCCTGTCCACCCGTCGACTACGCCCAAGGCGAGGCGCCCAAAACGTGCTCGC
TCGGGCAGCTGCCCGTCTACGTCGTCGAGGCCGTCGATCGGTCGGACATCGCCGAGGCCCTCCGGTTCACGCGGG
AGCACAACATCCGCGTCACCGTCACCAACACGGGCCACGACCTCAACGGCCGCTCCGACGGCTTCGGGAGCCTGA
CCATCTGGCTGCAGAAGTTCCGCAAGGGCATCAGCTTCCAGCCCCGGCTGCAGTCCGCCACCGGATGCGCCGCCT
CCAACTGGAGCGGCAGCGCCCTGCGTCTCGACGGCGCCTATCGCTGGCGGGACGTCGTCAAGGTGGCCAAGGAGA
AGAAGGTGATGGTCGTCAGCGGCGGCTCGGGCTCGCCCGGGGCCAGCGGCGGCTGGATGCTGGGCGGCGGCCACG
GGCCGGCCTCGCGCGAGTACGGGCTCGGCGCCGACCAGCTTCTCGAGGCCGAGGTGATGCTCGCCAACGGCTCCG
TCGTCACCGCCAACCACTGCCAGCACCCGGACCTGTTCCGCTCCCTGCGCGGCGGCGGCCCGGGCTACGGCGTCG
TGCTCGGCGTCACCATCAAGGCCTATCTGATGCCCGACACGTGGAGCATGACGGTCCACCAGCTGGACCTCTGGC
CCGAGACGCAGACGGACAGCAACTCGGAGCTCCTCGACGCCGTGGCCCACCTGGCTCAGTCGTTCCCGCAGCTCA
ACGACGCCGGCTTCTCCGGGTACGGCGTCTGGTTCCGGAACCTGCGGGGCGAGTTTATGGGCGGCCGCCGCTCCG
GCTACAACCACAAGCTCTGGATCGTGGGCAAGAACAAGACCGAGGCCTGGAGCCTGTTCGAGCCGGTGCGGGCCA
GTCTCGACACCCTGAAAGGTGCCGTCGTCCTCAACGAGACGCTGCGCGAGTATCGCAACTTCTGGACCTTCTTCG
ACACGGAGCTGGGCCACGACGACGTCTCCGGCTTGTCCCTCTACACCACCTCGCGCTTCCTGGACAAGCCGGCCG
TCGCCGACTTACGCAAGCTCCGCGAGGCCGTCGACGTCGTGAGCGGCCGGCCCGAGGAGTACACCATGAACATCC
TGGCGCTCGGCTCCGGCGGCAAGGTGTTCGAGGACGCGGCCGACACGTCGTCGGGCCTCCATCCGGCTTGGCGCA
CCGCCCCGATGTTCCTCATCACCGGCCGCCGGGCCGCCCACTCGGCCACCGAGGCCGAGCGCCGGGCCGTCATGG
ACGACATCACTCGCGTCAAGGGCGCCGCCACCAAGAGCCTCGCCCCCGACACGGGCGCCTACATGAACGAGGGCG
ACCGCAACGACCCGGACTGGAAGCAGGCCTTCTACGGGTCAAACTACGGCCACCACCTGGCGACCAAGCACGCCT
ACGACCCGGACAAGGTCTTCTACTGTCCGACCTGCGTCGGATCCGACGAGTTTGTCAGCCGCGAGGACGGAGCCC
TGTGTCTGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail