Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7894
Gene name
LocationContig_486:7953..16405
Strand+
Gene length (bp)8452
Transcript length (bp)8295
Coding sequence length (bp)8295
Protein length (aa) 2765

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 9.4E-16 2397 2544
PF00534 Glycos_transf_1 Glycosyl transferases group 1 1.7E-15 2393 2543

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 720 742 22
2 755 777 22
3 797 819 22
4 826 848 22
5 1080 1102 22
6 1142 1164 22
7 1169 1188 19
8 1200 1222 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7894
LGAASPPKKGLGCVDLASLGSRALEDDRLTETAQLLAGACVDKNLSGLAFRLSSSLQSKKVEKLMQRLSSNDFPA
LVFLHHDSTTLDSLSLEHAAGVVIQNAVILPNGQRRDYFQAQGLRSIMARSVKERERKPEFFIGFLELWELQPHP
AVIRRAVKLAEHFGAAVQHAPSSPSLGPERRLVGADRTLSAFEYLKRPDLTKLQQYWTKEQRKIWIPNGKQAPEM
RSLNVELLGTVVPSVPNLLLPEALPPSLSKLQSELPALYEPPDYASKVPLREDFWHSSRDGNIMAPLGCYSICSE
PSPEDYASVVQTQQHLKQLDLLHYMKGVASFRLLEALRTLASREQCGHLVQDLIDGLESQQICVYKGLDTGFRIP
DGEACFWGVSRARDDRTRLSVDIFISQKAPNNATTILHTWLAHNGVPRDVRYDLEVLLEAASGIDDAANGLPLSI
RTGIEQATNAETLQLLQQMQATRLEGHLKGSMVKFCRLKLINRTTTKSRTRTYGRGLLDGSMTMREALEIRLETL
AQLGAARLPLLEKLLELHDLVDGTVRDALFFGDKDRLNALAASLAQAFDMPSSDPDSYVDVNTDLFALIFFSVLR
KAAFEDVYIEATDRCPLFLQPDQAAVFSELWVLGSQCEAYFGILPRDLGEIIYDRYRLFLEERAPSAADRTGNEI
MTMYSSSESSPQAVAAKSSKWRATLGGQTTMFEKLEQWKTRFAEFGAMSIFCLPAIIDVVLLTFLGRGMFMTAFM
HPDHLRAAVYALLISLLLSAGVVGWVGSSGNYYLAHYAYDNMIYFHVQRLSGGFVLVLVVAAAGLIGFSVASSVA
VGFVFVAFLIAITTYLNLLGILATMHQQNSPMTSGRTVVWRNIPLLLLSPAISCFVNGHDLEIYLPTIYCFLLLL
TYQYRQLCHEWSGWMRNIPDFSDKDVLEWYVAKCQPDADSTEGSQVSGKDAQEAFREAVSSYRRRTRGAASSGVL
RDAFVGRVSKSMPYVDWLFKKAAPDGNVPPAFSNGWFTQLGDAKKQQQQLARGLKEHNIFMLFRMARYDIGQNLG
LFLVALMDRWVSVVMSAREPHASIYTDSRARYGICFCILYFSFSVMILDLVLQKYWSLRFTSSKEPLVDFNHARM
VAMDWERMRRRTLTGALIELFRKIIIVFGATTIFLWLFVESNETMTLYYMYVLGYTCVIIFQFNRCFTTNVSAHV
TIIFVSAICGFVLGCVLHAVPATAGWLYSDIIAQNCAAVLAAIGTLAWSWSDFSTPRDTKLAHQSSAKSTRARRL
WAQRKIMAEGDAETRIPLVKFRKMDGIVYSHEDGSIVSQTIVQLLRKSLSLRNNTARNSSWSTDLMDTVMRMWSA
RRARIVAVDCDAFSAAGLDGICSVSQMGDGGILTIKIGLFGETELRLPSWQSLLGTVSAECLLYHVARVEFNRSH
AQAVQAEHFLNRTTDMSKRIELELATGGSQDLKRVISKTTAELMRHLCWNVDVQADWQTVPQCGREAIFCRIAGQ
PVSFTEELSRWISRERIDLHAVDFHLNLCLCIFHDCNERLLSTVVFPGGDQAEVFKHAAQLKPARVYNLRAPTNL
LQRFFRAFTAVPLSVVKWIAIISGGGSNIERELWYGLRNVFCGHMILRATLAVWRLCRALKELLMHALLIYHRHS
LVNITRLAQKGERRKIKRNAIVVDWARKPITAFASSGLDERTHMTVEAFDGPQQSPPPDKSFAFKANYDEHFRLV
SREDRNDKTTSIYNYSSRGHDRWPQSKEVVGEKHWLIGIYDSCGRIKHGIMTLSDSSRLNFCYHYKATPKGNSII
LAADFVPVVKSGPVDKLSVYWGPPRRDATNSYDWVPSDKVYRIVRIINGRRFVTELEYNHRRDPVSTTIVEEENE
LKTAVAEVPKLPFEEDSLFKKPVNLSFAYDDILIHHNILQLRRLRQYAVNTLSIVSRWSPLHLWKRKVYLSVPTW
RIRTELWNSWLNDSLDAATVCWMDELILREEPLLRKYWRARESGRLEDARRALDGDINQIVSAIELETDISELCL
LPIRTSDLYAMGLGRDATEVTNRPQDCYKDTEDRLSVIVNDIGCWPEAPGGVSNCRRDLVNGHSTIRNHVLAECA
HDFGIPRFQVEKSVQSLKLLPLWGLDGKTAYHGLMENILQSQVDEKIRDTDLQRDIIGVFIPLLKDFVRGARTKS
YSHADLVRYTNVFLSMSKYYEHKDYNQTWSSKAVEDAWAEAWLVPYKDANITDPAEHFDMQRPSMADFKDALGIY
LAYFFIFSVRIPEECPRVFQSTHHGISSLFGMLLKYRRGVTFGIWDHAILWRESCLNISPAQCELSVPVQSMLLA
GIRLASRLAYLHADIVVPCTSLFNPMWETEIGTDKGKICSKNEFRRKIDPIVNGISNMESFTPVDKVRTDKPTVV
MLSNVQFIKGIKPAILAADIIVNRYGFRDYRLLIYGAKDRQPSYALEMAKLIVKCNLSENVVLAGFGKPKEVLQD
AWLFVNSSISEGLPLAIGEAALAGVPIVATEVGATALVVTDPDDQGQRYGEVVAPNDPIALARAQLSLLCMVGPW
ARFTQDGEKGEVGGLPEEMRPEDVEWLCRRMYEKSEDRRRLGLLSREVVLHSFHGRRYLREHEQMYWIQWHMAKM
RADQTADTGSRNAFKFGSRPPLKYTESDSFGEDEAAKVAEEEEEEEEEGEEGKEGEERRPGRADGAEAEERMTLV
SSPTGSVDSEAQTARKSNSRSGLSRLLRGPSGIGLGRHHHHSRHVPYSPGGSTAASSFSNWAPG*
Coding >Hirsu2|7894
CTGGGCGCCGCCAGCCCGCCCAAGAAGGGCCTCGGTTGCGTCGATCTCGCATCGCTCGGTTCCAGGGCACTCGAG
GATGACCGCCTGACTGAGACGGCACAGCTTCTCGCCGGAGCTTGCGTTGACAAGAATCTCTCCGGTCTCGCTTTC
CGGCTCTCGTCCTCGCTGCAGTCCAAGAAGGTCGAGAAGCTGATGCAAAGGCTCTCATCCAACGACTTCCCGGCC
CTAGTCTTCCTCCATCACGACTCAACAACGCTCGACTCTCTCAGCCTCGAGCACGCTGCCGGCGTCGTCATCCAG
AATGCTGTGATCCTCCCCAACGGCCAACGCCGAGACTACTTTCAAGCTCAGGGACTTCGCAGCATCATGGCCAGA
AGCGTCAAGGAGCGTGAGAGAAAGCCCGAGTTCTTCATCGGTTTCCTCGAGCTATGGGAGCTCCAGCCGCATCCT
GCCGTCATCCGTCGTGCCGTCAAGTTGGCCGAGCATTTTGGCGCCGCTGTGCAGCACGCCCCTTCGAGCCCGTCC
CTGGGTCCCGAGAGGCGCTTAGTCGGAGCAGATCGCACCTTGAGCGCCTTTGAGTATTTAAAGCGACCGGATCTG
ACAAAGCTGCAACAATACTGGACGAAAGAGCAGCGAAAAATCTGGATTCCAAACGGTAAACAAGCCCCAGAGATG
AGGTCGCTGAATGTCGAGCTTCTGGGCACGGTGGTCCCATCCGTACCCAATCTTTTGCTTCCTGAGGCTCTACCA
CCATCGCTCAGCAAGTTGCAGTCGGAGCTCCCGGCCTTGTATGAGCCGCCCGACTACGCGTCAAAAGTGCCCTTG
CGCGAAGACTTTTGGCACTCTTCACGCGATGGAAACATCATGGCGCCGCTGGGGTGCTACTCAATCTGCTCCGAA
CCGTCGCCGGAAGATTATGCATCTGTCGTGCAGACTCAGCAGCATCTCAAACAACTCGACCTGCTGCACTACATG
AAGGGTGTTGCGTCCTTCAGGCTGCTGGAGGCCCTGCGAACGCTGGCTTCTCGGGAGCAGTGCGGTCACTTGGTC
CAAGACTTGATCGATGGCCTGGAATCTCAACAGATCTGCGTCTACAAGGGCCTAGACACGGGCTTTCGGATTCCT
GACGGGGAGGCCTGCTTCTGGGGAGTGTCACGCGCCCGGGACGATAGGACGAGGCTCTCTGTAGACATATTCATC
TCCCAAAAGGCGCCGAACAACGCGACGACAATTCTTCACACGTGGCTGGCTCATAACGGAGTGCCCCGCGACGTA
CGATATGACCTCGAAGTTCTGCTCGAGGCCGCCAGTGGCATCGACGACGCGGCAAACGGCTTACCCCTGAGCATC
CGGACTGGAATCGAGCAAGCCACTAACGCAGAGACGCTGCAGCTGCTGCAGCAGATGCAGGCGACGCGGCTCGAA
GGCCATCTCAAAGGCTCCATGGTCAAGTTTTGCAGGCTGAAGCTCATAAATCGGACAACAACCAAGTCCCGGACA
CGGACGTACGGCCGTGGACTGCTGGATGGCTCCATGACCATGCGTGAGGCACTGGAGATTCGACTCGAAACTTTG
GCGCAGCTCGGCGCAGCTCGGCTGCCACTTCTGGAGAAACTGTTAGAGCTGCACGACCTCGTTGATGGGACCGTT
CGCGATGCCCTTTTCTTCGGCGACAAGGATCGCCTGAACGCCCTGGCAGCATCCCTGGCTCAGGCATTTGATATG
CCTTCGTCGGATCCTGACAGCTATGTGGACGTCAACACCGATCTCTTCGCCCTCATCTTCTTCAGCGTATTGAGG
AAGGCCGCTTTCGAAGACGTCTACATCGAGGCTACGGACCGCTGCCCCCTCTTCCTTCAGCCTGACCAGGCGGCC
GTCTTCTCGGAGCTGTGGGTACTCGGGTCGCAGTGCGAAGCCTACTTCGGGATCCTGCCCCGGGACTTGGGCGAA
ATCATATACGATCGCTACCGCTTGTTCCTGGAGGAACGGGCACCTAGTGCCGCCGACCGTACTGGCAACGAAATC
ATGACCATGTACTCGAGCTCCGAGTCGAGCCCGCAAGCCGTCGCTGCCAAAAGCAGCAAATGGAGAGCCACCCTG
GGCGGACAGACGACCATGTTTGAGAAGCTTGAACAATGGAAGACGCGCTTCGCCGAGTTCGGCGCCATGTCAATC
TTCTGTCTGCCTGCCATCATCGACGTCGTGTTGCTAACGTTCCTCGGCCGCGGCATGTTCATGACGGCCTTTATG
CACCCGGACCACCTTCGGGCCGCCGTCTATGCCCTCCTCATCTCCCTTCTGCTGTCCGCTGGCGTGGTCGGTTGG
GTTGGCAGCTCTGGCAACTACTACCTGGCTCATTACGCTTATGACAACATGATTTACTTTCATGTCCAGCGGCTC
TCTGGCGGCTTCGTCCTTGTCCTCGTCGTTGCCGCTGCCGGCCTCATTGGCTTTTCTGTGGCAAGTTCTGTTGCC
GTTGGCTTCGTCTTCGTCGCCTTCCTCATCGCCATCACCACCTATCTTAATCTTCTCGGCATTCTCGCAACGATG
CATCAGCAGAATAGTCCCATGACGTCAGGTCGCACCGTCGTCTGGCGAAACATCCCTCTGCTCTTGCTGTCGCCC
GCCATTTCATGCTTCGTGAACGGCCACGACCTCGAGATATACCTGCCCACCATATACTGCTTCCTCCTGCTCCTG
ACATATCAGTACCGACAGCTTTGCCACGAGTGGTCCGGGTGGATGCGCAACATTCCGGACTTCTCTGACAAGGAC
GTCCTGGAATGGTACGTGGCCAAGTGTCAGCCGGACGCGGACTCTACGGAGGGGTCGCAAGTCAGTGGCAAGGAT
GCACAGGAGGCTTTTCGCGAGGCTGTCTCGTCTTACCGCAGACGGACTCGGGGAGCAGCATCATCCGGAGTTCTA
AGAGATGCCTTTGTTGGCCGCGTGTCCAAGAGCATGCCGTACGTCGACTGGCTGTTCAAAAAGGCGGCCCCGGAC
GGCAACGTACCGCCGGCGTTCAGCAATGGCTGGTTCACACAACTAGGCGACGCAAAGAAGCAGCAGCAGCAGCTC
GCGCGTGGACTCAAGGAGCACAACATCTTCATGCTTTTCCGCATGGCTCGCTACGACATCGGGCAGAACTTGGGC
TTGTTTCTCGTCGCCCTCATGGACCGCTGGGTCAGCGTCGTCATGTCAGCGAGGGAGCCGCATGCCAGCATCTAC
ACCGACTCCCGCGCCCGGTATGGCATTTGTTTTTGCATCCTGTATTTCAGCTTTTCCGTCATGATTCTCGACCTC
GTCCTGCAGAAGTACTGGAGTTTGCGCTTCACATCGTCCAAGGAGCCGCTCGTCGACTTCAACCATGCGCGAATG
GTGGCCATGGACTGGGAGAGGATGCGGCGGAGAACATTGACCGGGGCCTTGATCGAGCTTTTCAGAAAGATCATA
ATCGTCTTCGGCGCCACCACCATCTTTCTCTGGCTCTTCGTGGAAAGCAACGAAACCATGACGCTCTATTACATG
TACGTCCTCGGGTACACGTGTGTTATCATCTTCCAATTCAACCGCTGCTTCACGACAAATGTCAGCGCCCACGTC
ACAATCATCTTCGTGTCGGCAATCTGCGGCTTCGTTCTTGGATGTGTTCTTCACGCCGTTCCCGCCACGGCGGGC
TGGCTCTACTCGGATATCATAGCCCAGAACTGCGCTGCCGTGCTGGCGGCGATTGGAACGCTCGCCTGGTCGTGG
AGCGATTTTTCCACTCCAAGAGATACAAAGCTGGCACACCAGAGCTCCGCCAAGTCGACGCGGGCTCGAAGGCTC
TGGGCCCAGAGGAAAATTATGGCAGAGGGCGACGCCGAGACGAGAATACCGCTGGTCAAGTTCAGGAAGATGGAC
GGCATAGTCTACTCGCACGAAGACGGCTCCATCGTTTCGCAGACCATTGTGCAGCTCCTTCGCAAAAGCCTCAGC
CTGCGAAACAACACGGCCAGAAACTCATCTTGGTCGACTGACCTCATGGATACCGTCATGAGGATGTGGTCAGCA
CGCCGTGCCCGAATCGTGGCTGTCGACTGTGACGCCTTTTCCGCTGCCGGCCTGGACGGCATTTGCTCGGTCAGT
CAGATGGGCGATGGTGGAATCCTGACCATCAAGATCGGCCTGTTCGGAGAGACGGAGCTTCGCTTGCCCTCGTGG
CAGTCTCTGCTGGGCACCGTGTCTGCCGAATGTCTGCTTTATCACGTGGCCCGCGTCGAGTTCAACCGTTCCCAC
GCCCAAGCGGTGCAAGCAGAGCACTTCCTGAACAGGACAACTGACATGTCCAAACGCATCGAGCTCGAGCTGGCC
ACCGGCGGCTCGCAAGACTTGAAGCGCGTTATTAGCAAGACGACTGCCGAGCTCATGCGCCATCTGTGTTGGAAC
GTCGACGTACAGGCAGACTGGCAGACCGTTCCTCAATGCGGCCGAGAGGCCATATTTTGCCGCATCGCCGGCCAG
CCTGTTTCTTTCACCGAGGAGCTCTCTCGGTGGATTTCTCGAGAGCGAATCGACTTACACGCTGTAGACTTCCAT
CTCAATCTCTGTCTCTGCATCTTCCACGACTGCAACGAGCGATTACTGTCGACCGTTGTCTTTCCCGGCGGCGAT
CAAGCCGAGGTCTTCAAGCACGCCGCCCAGCTGAAACCGGCTCGAGTCTACAACTTACGAGCACCGACGAACTTG
CTGCAACGTTTCTTTCGTGCCTTCACTGCGGTCCCTCTCTCGGTCGTCAAATGGATAGCCATCATTTCTGGCGGA
GGATCCAACATTGAACGAGAGCTCTGGTACGGCCTGCGGAATGTGTTCTGCGGCCATATGATTTTGCGAGCCACT
CTGGCAGTCTGGAGGCTGTGCAGGGCATTGAAAGAGCTTCTCATGCATGCGCTGCTGATTTATCATCGTCACTCC
CTCGTCAATATCACTCGGCTAGCGCAGAAGGGAGAGCGGCGCAAGATCAAACGAAACGCTATCGTGGTCGATTGG
GCCCGCAAGCCCATCACGGCTTTCGCCAGCAGTGGCCTCGACGAGAGGACACACATGACTGTTGAGGCATTCGAC
GGGCCTCAGCAGAGTCCCCCACCAGACAAGTCGTTTGCATTCAAAGCAAACTACGACGAGCACTTCCGCCTTGTC
AGCAGAGAAGACAGAAACGACAAGACAACGTCAATCTACAATTACAGCTCCCGAGGTCACGATCGGTGGCCGCAG
TCCAAGGAAGTCGTGGGCGAAAAGCACTGGTTGATCGGCATTTACGACAGCTGCGGCCGCATCAAGCATGGCATC
ATGACATTGAGCGACTCTTCGAGGCTCAACTTCTGTTACCATTACAAGGCAACCCCCAAGGGCAACTCCATCATT
CTGGCGGCAGATTTCGTACCCGTCGTCAAGTCCGGGCCCGTGGACAAGCTGTCCGTCTACTGGGGACCTCCCCGC
AGGGACGCGACGAACAGCTATGACTGGGTCCCATCGGACAAGGTCTATCGCATTGTCAGGATCATCAACGGCAGG
AGGTTTGTTACCGAGCTGGAGTACAACCATCGCCGGGACCCCGTCAGCACAACGATTGTTGAAGAGGAAAACGAG
CTGAAAACGGCAGTGGCCGAGGTTCCCAAGCTTCCCTTTGAGGAGGATTCGTTGTTCAAGAAGCCGGTGAATCTC
TCGTTTGCCTACGATGACATCCTCATCCACCACAACATCCTCCAGCTGAGGCGCCTGAGGCAGTACGCCGTCAAC
ACGCTGTCCATCGTGTCGCGCTGGAGTCCCTTGCACCTTTGGAAAAGGAAGGTGTATCTGTCTGTCCCAACGTGG
CGCATCCGCACCGAGCTATGGAATAGCTGGCTGAATGACAGCTTGGATGCCGCGACTGTCTGCTGGATGGACGAG
CTCATTCTTCGCGAAGAGCCGCTGCTGCGCAAGTACTGGCGTGCCCGCGAAAGCGGGCGGCTGGAAGACGCGAGG
CGGGCATTGGACGGAGACATCAACCAGATTGTGTCCGCCATCGAGCTGGAGACGGACATCTCGGAGCTTTGCCTG
CTCCCCATCCGGACTTCGGACCTTTACGCCATGGGCTTGGGCAGAGATGCGACCGAAGTCACGAACCGGCCACAG
GACTGCTACAAGGACACGGAGGACCGCCTGTCCGTCATCGTCAACGATATCGGATGCTGGCCCGAGGCGCCCGGG
GGGGTGTCCAACTGCAGGAGAGACCTGGTCAACGGGCACAGCACGATCCGCAACCACGTCTTGGCGGAGTGCGCC
CACGACTTTGGCATCCCGAGGTTCCAGGTCGAGAAGAGCGTGCAGTCGCTCAAGCTGCTGCCCCTCTGGGGTCTC
GACGGCAAGACGGCCTATCACGGGCTCATGGAGAATATCCTGCAATCGCAGGTGGACGAGAAAATCCGCGACACA
GACCTTCAGAGAGACATCATCGGGGTCTTCATCCCACTCCTCAAAGACTTCGTCAGGGGGGCCCGTACCAAGAGC
TACTCCCACGCGGACCTGGTCAGGTACACCAACGTCTTCCTCTCCATGTCCAAGTACTACGAGCACAAGGACTAC
AACCAAACGTGGAGCTCCAAGGCAGTCGAGGACGCGTGGGCCGAGGCCTGGCTCGTGCCGTACAAGGATGCCAAC
ATCACCGATCCGGCCGAGCACTTTGACATGCAGAGGCCCAGCATGGCCGACTTCAAGGACGCGCTGGGCATCTAC
CTTGCCTATTTCTTCATCTTCTCCGTCAGGATCCCCGAGGAGTGCCCGCGCGTGTTCCAGAGCACCCACCACGGC
ATCAGCAGCCTCTTTGGCATGCTGCTCAAATACCGCCGCGGCGTGACGTTTGGCATCTGGGACCACGCCATTCTG
TGGCGGGAGAGTTGCCTCAACATCAGCCCGGCCCAGTGCGAGCTGTCGGTGCCGGTGCAGTCGATGCTCCTGGCG
GGGATCCGCCTGGCCAGCCGCCTGGCCTACCTGCACGCCGACATTGTCGTGCCGTGCACGTCGCTGTTCAACCCA
ATGTGGGAAACAGAAATCGGGACGGACAAGGGCAAGATTTGCAGCAAGAACGAGTTCCGGCGCAAGATCGACCCC
ATCGTCAACGGCATCAGCAACATGGAGTCGTTCACGCCGGTCGACAAGGTGCGGACGGACAAGCCGACGGTGGTG
ATGCTGTCGAACGTGCAGTTCATCAAGGGCATCAAGCCGGCGATCCTGGCGGCCGACATCATCGTCAACCGCTAC
GGGTTCCGCGACTACAGGCTGTTGATCTACGGGGCCAAGGATCGCCAGCCGTCGTACGCGCTCGAGATGGCCAAG
CTGATTGTCAAGTGCAACCTGTCGGAGAACGTGGTCCTGGCCGGGTTCGGCAAGCCCAAGGAGGTGCTGCAGGAC
GCCTGGCTCTTCGTCAACTCGTCCATCTCGGAAGGGCTGCCGCTGGCCATCGGAGAGGCGGCGCTGGCGGGCGTC
CCCATCGTCGCGACCGAAGTGGGAGCCACGGCGCTGGTGGTGACGGACCCGGACGACCAAGGGCAGAGGTACGGC
GAGGTGGTGGCGCCCAACGACCCGATTGCCCTCGCGCGGGCGCAGCTGAGCCTGCTCTGCATGGTCGGCCCCTGG
GCGCGCTTCACGCAGGACGGCGAGAAGGGCGAGGTTGGGGGGCTGCCGGAAGAGATGAGGCCGGAAGACGTCGAG
TGGCTCTGTCGACGGATGTACGAGAAGAGCGAGGACCGGAGGCGGCTCGGCCTGCTGTCACGCGAGGTGGTGCTG
CACAGCTTCCACGGGCGCCGGTACCTGCGCGAGCACGAGCAGATGTACTGGATCCAGTGGCACATGGCCAAGATG
AGGGCGGACCAGACGGCGGACACGGGGTCCAGGAACGCCTTCAAGTTTGGCTCTCGGCCGCCGCTCAAGTACACG
GAGTCGGACTCGTTCGGAGAGGACGAGGCGGCCAAGGTGGCAGAGGAGGAGGAGGAGGAGGAGGAGGAGGGGGAG
GAGGGGAAGGAGGGGGAGGAGAGAAGACCTGGTCGGGCCGACGGAGCAGAAGCGGAAGAGAGGATGACGTTGGTA
TCGTCGCCCACGGGCAGTGTCGACTCGGAAGCGCAGACGGCGCGGAAGTCGAACTCCAGGTCGGGCCTGTCGAGG
CTCTTGCGAGGACCGAGCGGCATCGGCCTCGGCCGGCACCATCACCACAGCAGGCACGTGCCGTATAGCCCGGGA
GGCTCGACGGCGGCGAGCAGCTTCAGCAACTGGGCGCCGGGATAG
Transcript >Hirsu2|7894
CTGGGCGCCGCCAGCCCGCCCAAGAAGGGCCTCGGTTGCGTCGATCTCGCATCGCTCGGTTCCAGGGCACTCGAG
GATGACCGCCTGACTGAGACGGCACAGCTTCTCGCCGGAGCTTGCGTTGACAAGAATCTCTCCGGTCTCGCTTTC
CGGCTCTCGTCCTCGCTGCAGTCCAAGAAGGTCGAGAAGCTGATGCAAAGGCTCTCATCCAACGACTTCCCGGCC
CTAGTCTTCCTCCATCACGACTCAACAACGCTCGACTCTCTCAGCCTCGAGCACGCTGCCGGCGTCGTCATCCAG
AATGCTGTGATCCTCCCCAACGGCCAACGCCGAGACTACTTTCAAGCTCAGGGACTTCGCAGCATCATGGCCAGA
AGCGTCAAGGAGCGTGAGAGAAAGCCCGAGTTCTTCATCGGTTTCCTCGAGCTATGGGAGCTCCAGCCGCATCCT
GCCGTCATCCGTCGTGCCGTCAAGTTGGCCGAGCATTTTGGCGCCGCTGTGCAGCACGCCCCTTCGAGCCCGTCC
CTGGGTCCCGAGAGGCGCTTAGTCGGAGCAGATCGCACCTTGAGCGCCTTTGAGTATTTAAAGCGACCGGATCTG
ACAAAGCTGCAACAATACTGGACGAAAGAGCAGCGAAAAATCTGGATTCCAAACGGTAAACAAGCCCCAGAGATG
AGGTCGCTGAATGTCGAGCTTCTGGGCACGGTGGTCCCATCCGTACCCAATCTTTTGCTTCCTGAGGCTCTACCA
CCATCGCTCAGCAAGTTGCAGTCGGAGCTCCCGGCCTTGTATGAGCCGCCCGACTACGCGTCAAAAGTGCCCTTG
CGCGAAGACTTTTGGCACTCTTCACGCGATGGAAACATCATGGCGCCGCTGGGGTGCTACTCAATCTGCTCCGAA
CCGTCGCCGGAAGATTATGCATCTGTCGTGCAGACTCAGCAGCATCTCAAACAACTCGACCTGCTGCACTACATG
AAGGGTGTTGCGTCCTTCAGGCTGCTGGAGGCCCTGCGAACGCTGGCTTCTCGGGAGCAGTGCGGTCACTTGGTC
CAAGACTTGATCGATGGCCTGGAATCTCAACAGATCTGCGTCTACAAGGGCCTAGACACGGGCTTTCGGATTCCT
GACGGGGAGGCCTGCTTCTGGGGAGTGTCACGCGCCCGGGACGATAGGACGAGGCTCTCTGTAGACATATTCATC
TCCCAAAAGGCGCCGAACAACGCGACGACAATTCTTCACACGTGGCTGGCTCATAACGGAGTGCCCCGCGACGTA
CGATATGACCTCGAAGTTCTGCTCGAGGCCGCCAGTGGCATCGACGACGCGGCAAACGGCTTACCCCTGAGCATC
CGGACTGGAATCGAGCAAGCCACTAACGCAGAGACGCTGCAGCTGCTGCAGCAGATGCAGGCGACGCGGCTCGAA
GGCCATCTCAAAGGCTCCATGGTCAAGTTTTGCAGGCTGAAGCTCATAAATCGGACAACAACCAAGTCCCGGACA
CGGACGTACGGCCGTGGACTGCTGGATGGCTCCATGACCATGCGTGAGGCACTGGAGATTCGACTCGAAACTTTG
GCGCAGCTCGGCGCAGCTCGGCTGCCACTTCTGGAGAAACTGTTAGAGCTGCACGACCTCGTTGATGGGACCGTT
CGCGATGCCCTTTTCTTCGGCGACAAGGATCGCCTGAACGCCCTGGCAGCATCCCTGGCTCAGGCATTTGATATG
CCTTCGTCGGATCCTGACAGCTATGTGGACGTCAACACCGATCTCTTCGCCCTCATCTTCTTCAGCGTATTGAGG
AAGGCCGCTTTCGAAGACGTCTACATCGAGGCTACGGACCGCTGCCCCCTCTTCCTTCAGCCTGACCAGGCGGCC
GTCTTCTCGGAGCTGTGGGTACTCGGGTCGCAGTGCGAAGCCTACTTCGGGATCCTGCCCCGGGACTTGGGCGAA
ATCATATACGATCGCTACCGCTTGTTCCTGGAGGAACGGGCACCTAGTGCCGCCGACCGTACTGGCAACGAAATC
ATGACCATGTACTCGAGCTCCGAGTCGAGCCCGCAAGCCGTCGCTGCCAAAAGCAGCAAATGGAGAGCCACCCTG
GGCGGACAGACGACCATGTTTGAGAAGCTTGAACAATGGAAGACGCGCTTCGCCGAGTTCGGCGCCATGTCAATC
TTCTGTCTGCCTGCCATCATCGACGTCGTGTTGCTAACGTTCCTCGGCCGCGGCATGTTCATGACGGCCTTTATG
CACCCGGACCACCTTCGGGCCGCCGTCTATGCCCTCCTCATCTCCCTTCTGCTGTCCGCTGGCGTGGTCGGTTGG
GTTGGCAGCTCTGGCAACTACTACCTGGCTCATTACGCTTATGACAACATGATTTACTTTCATGTCCAGCGGCTC
TCTGGCGGCTTCGTCCTTGTCCTCGTCGTTGCCGCTGCCGGCCTCATTGGCTTTTCTGTGGCAAGTTCTGTTGCC
GTTGGCTTCGTCTTCGTCGCCTTCCTCATCGCCATCACCACCTATCTTAATCTTCTCGGCATTCTCGCAACGATG
CATCAGCAGAATAGTCCCATGACGTCAGGTCGCACCGTCGTCTGGCGAAACATCCCTCTGCTCTTGCTGTCGCCC
GCCATTTCATGCTTCGTGAACGGCCACGACCTCGAGATATACCTGCCCACCATATACTGCTTCCTCCTGCTCCTG
ACATATCAGTACCGACAGCTTTGCCACGAGTGGTCCGGGTGGATGCGCAACATTCCGGACTTCTCTGACAAGGAC
GTCCTGGAATGGTACGTGGCCAAGTGTCAGCCGGACGCGGACTCTACGGAGGGGTCGCAAGTCAGTGGCAAGGAT
GCACAGGAGGCTTTTCGCGAGGCTGTCTCGTCTTACCGCAGACGGACTCGGGGAGCAGCATCATCCGGAGTTCTA
AGAGATGCCTTTGTTGGCCGCGTGTCCAAGAGCATGCCGTACGTCGACTGGCTGTTCAAAAAGGCGGCCCCGGAC
GGCAACGTACCGCCGGCGTTCAGCAATGGCTGGTTCACACAACTAGGCGACGCAAAGAAGCAGCAGCAGCAGCTC
GCGCGTGGACTCAAGGAGCACAACATCTTCATGCTTTTCCGCATGGCTCGCTACGACATCGGGCAGAACTTGGGC
TTGTTTCTCGTCGCCCTCATGGACCGCTGGGTCAGCGTCGTCATGTCAGCGAGGGAGCCGCATGCCAGCATCTAC
ACCGACTCCCGCGCCCGGTATGGCATTTGTTTTTGCATCCTGTATTTCAGCTTTTCCGTCATGATTCTCGACCTC
GTCCTGCAGAAGTACTGGAGTTTGCGCTTCACATCGTCCAAGGAGCCGCTCGTCGACTTCAACCATGCGCGAATG
GTGGCCATGGACTGGGAGAGGATGCGGCGGAGAACATTGACCGGGGCCTTGATCGAGCTTTTCAGAAAGATCATA
ATCGTCTTCGGCGCCACCACCATCTTTCTCTGGCTCTTCGTGGAAAGCAACGAAACCATGACGCTCTATTACATG
TACGTCCTCGGGTACACGTGTGTTATCATCTTCCAATTCAACCGCTGCTTCACGACAAATGTCAGCGCCCACGTC
ACAATCATCTTCGTGTCGGCAATCTGCGGCTTCGTTCTTGGATGTGTTCTTCACGCCGTTCCCGCCACGGCGGGC
TGGCTCTACTCGGATATCATAGCCCAGAACTGCGCTGCCGTGCTGGCGGCGATTGGAACGCTCGCCTGGTCGTGG
AGCGATTTTTCCACTCCAAGAGATACAAAGCTGGCACACCAGAGCTCCGCCAAGTCGACGCGGGCTCGAAGGCTC
TGGGCCCAGAGGAAAATTATGGCAGAGGGCGACGCCGAGACGAGAATACCGCTGGTCAAGTTCAGGAAGATGGAC
GGCATAGTCTACTCGCACGAAGACGGCTCCATCGTTTCGCAGACCATTGTGCAGCTCCTTCGCAAAAGCCTCAGC
CTGCGAAACAACACGGCCAGAAACTCATCTTGGTCGACTGACCTCATGGATACCGTCATGAGGATGTGGTCAGCA
CGCCGTGCCCGAATCGTGGCTGTCGACTGTGACGCCTTTTCCGCTGCCGGCCTGGACGGCATTTGCTCGGTCAGT
CAGATGGGCGATGGTGGAATCCTGACCATCAAGATCGGCCTGTTCGGAGAGACGGAGCTTCGCTTGCCCTCGTGG
CAGTCTCTGCTGGGCACCGTGTCTGCCGAATGTCTGCTTTATCACGTGGCCCGCGTCGAGTTCAACCGTTCCCAC
GCCCAAGCGGTGCAAGCAGAGCACTTCCTGAACAGGACAACTGACATGTCCAAACGCATCGAGCTCGAGCTGGCC
ACCGGCGGCTCGCAAGACTTGAAGCGCGTTATTAGCAAGACGACTGCCGAGCTCATGCGCCATCTGTGTTGGAAC
GTCGACGTACAGGCAGACTGGCAGACCGTTCCTCAATGCGGCCGAGAGGCCATATTTTGCCGCATCGCCGGCCAG
CCTGTTTCTTTCACCGAGGAGCTCTCTCGGTGGATTTCTCGAGAGCGAATCGACTTACACGCTGTAGACTTCCAT
CTCAATCTCTGTCTCTGCATCTTCCACGACTGCAACGAGCGATTACTGTCGACCGTTGTCTTTCCCGGCGGCGAT
CAAGCCGAGGTCTTCAAGCACGCCGCCCAGCTGAAACCGGCTCGAGTCTACAACTTACGAGCACCGACGAACTTG
CTGCAACGTTTCTTTCGTGCCTTCACTGCGGTCCCTCTCTCGGTCGTCAAATGGATAGCCATCATTTCTGGCGGA
GGATCCAACATTGAACGAGAGCTCTGGTACGGCCTGCGGAATGTGTTCTGCGGCCATATGATTTTGCGAGCCACT
CTGGCAGTCTGGAGGCTGTGCAGGGCATTGAAAGAGCTTCTCATGCATGCGCTGCTGATTTATCATCGTCACTCC
CTCGTCAATATCACTCGGCTAGCGCAGAAGGGAGAGCGGCGCAAGATCAAACGAAACGCTATCGTGGTCGATTGG
GCCCGCAAGCCCATCACGGCTTTCGCCAGCAGTGGCCTCGACGAGAGGACACACATGACTGTTGAGGCATTCGAC
GGGCCTCAGCAGAGTCCCCCACCAGACAAGTCGTTTGCATTCAAAGCAAACTACGACGAGCACTTCCGCCTTGTC
AGCAGAGAAGACAGAAACGACAAGACAACGTCAATCTACAATTACAGCTCCCGAGGTCACGATCGGTGGCCGCAG
TCCAAGGAAGTCGTGGGCGAAAAGCACTGGTTGATCGGCATTTACGACAGCTGCGGCCGCATCAAGCATGGCATC
ATGACATTGAGCGACTCTTCGAGGCTCAACTTCTGTTACCATTACAAGGCAACCCCCAAGGGCAACTCCATCATT
CTGGCGGCAGATTTCGTACCCGTCGTCAAGTCCGGGCCCGTGGACAAGCTGTCCGTCTACTGGGGACCTCCCCGC
AGGGACGCGACGAACAGCTATGACTGGGTCCCATCGGACAAGGTCTATCGCATTGTCAGGATCATCAACGGCAGG
AGGTTTGTTACCGAGCTGGAGTACAACCATCGCCGGGACCCCGTCAGCACAACGATTGTTGAAGAGGAAAACGAG
CTGAAAACGGCAGTGGCCGAGGTTCCCAAGCTTCCCTTTGAGGAGGATTCGTTGTTCAAGAAGCCGGTGAATCTC
TCGTTTGCCTACGATGACATCCTCATCCACCACAACATCCTCCAGCTGAGGCGCCTGAGGCAGTACGCCGTCAAC
ACGCTGTCCATCGTGTCGCGCTGGAGTCCCTTGCACCTTTGGAAAAGGAAGGTGTATCTGTCTGTCCCAACGTGG
CGCATCCGCACCGAGCTATGGAATAGCTGGCTGAATGACAGCTTGGATGCCGCGACTGTCTGCTGGATGGACGAG
CTCATTCTTCGCGAAGAGCCGCTGCTGCGCAAGTACTGGCGTGCCCGCGAAAGCGGGCGGCTGGAAGACGCGAGG
CGGGCATTGGACGGAGACATCAACCAGATTGTGTCCGCCATCGAGCTGGAGACGGACATCTCGGAGCTTTGCCTG
CTCCCCATCCGGACTTCGGACCTTTACGCCATGGGCTTGGGCAGAGATGCGACCGAAGTCACGAACCGGCCACAG
GACTGCTACAAGGACACGGAGGACCGCCTGTCCGTCATCGTCAACGATATCGGATGCTGGCCCGAGGCGCCCGGG
GGGGTGTCCAACTGCAGGAGAGACCTGGTCAACGGGCACAGCACGATCCGCAACCACGTCTTGGCGGAGTGCGCC
CACGACTTTGGCATCCCGAGGTTCCAGGTCGAGAAGAGCGTGCAGTCGCTCAAGCTGCTGCCCCTCTGGGGTCTC
GACGGCAAGACGGCCTATCACGGGCTCATGGAGAATATCCTGCAATCGCAGGTGGACGAGAAAATCCGCGACACA
GACCTTCAGAGAGACATCATCGGGGTCTTCATCCCACTCCTCAAAGACTTCGTCAGGGGGGCCCGTACCAAGAGC
TACTCCCACGCGGACCTGGTCAGGTACACCAACGTCTTCCTCTCCATGTCCAAGTACTACGAGCACAAGGACTAC
AACCAAACGTGGAGCTCCAAGGCAGTCGAGGACGCGTGGGCCGAGGCCTGGCTCGTGCCGTACAAGGATGCCAAC
ATCACCGATCCGGCCGAGCACTTTGACATGCAGAGGCCCAGCATGGCCGACTTCAAGGACGCGCTGGGCATCTAC
CTTGCCTATTTCTTCATCTTCTCCGTCAGGATCCCCGAGGAGTGCCCGCGCGTGTTCCAGAGCACCCACCACGGC
ATCAGCAGCCTCTTTGGCATGCTGCTCAAATACCGCCGCGGCGTGACGTTTGGCATCTGGGACCACGCCATTCTG
TGGCGGGAGAGTTGCCTCAACATCAGCCCGGCCCAGTGCGAGCTGTCGGTGCCGGTGCAGTCGATGCTCCTGGCG
GGGATCCGCCTGGCCAGCCGCCTGGCCTACCTGCACGCCGACATTGTCGTGCCGTGCACGTCGCTGTTCAACCCA
ATGTGGGAAACAGAAATCGGGACGGACAAGGGCAAGATTTGCAGCAAGAACGAGTTCCGGCGCAAGATCGACCCC
ATCGTCAACGGCATCAGCAACATGGAGTCGTTCACGCCGGTCGACAAGGTGCGGACGGACAAGCCGACGGTGGTG
ATGCTGTCGAACGTGCAGTTCATCAAGGGCATCAAGCCGGCGATCCTGGCGGCCGACATCATCGTCAACCGCTAC
GGGTTCCGCGACTACAGGCTGTTGATCTACGGGGCCAAGGATCGCCAGCCGTCGTACGCGCTCGAGATGGCCAAG
CTGATTGTCAAGTGCAACCTGTCGGAGAACGTGGTCCTGGCCGGGTTCGGCAAGCCCAAGGAGGTGCTGCAGGAC
GCCTGGCTCTTCGTCAACTCGTCCATCTCGGAAGGGCTGCCGCTGGCCATCGGAGAGGCGGCGCTGGCGGGCGTC
CCCATCGTCGCGACCGAAGTGGGAGCCACGGCGCTGGTGGTGACGGACCCGGACGACCAAGGGCAGAGGTACGGC
GAGGTGGTGGCGCCCAACGACCCGATTGCCCTCGCGCGGGCGCAGCTGAGCCTGCTCTGCATGGTCGGCCCCTGG
GCGCGCTTCACGCAGGACGGCGAGAAGGGCGAGGTTGGGGGGCTGCCGGAAGAGATGAGGCCGGAAGACGTCGAG
TGGCTCTGTCGACGGATGTACGAGAAGAGCGAGGACCGGAGGCGGCTCGGCCTGCTGTCACGCGAGGTGGTGCTG
CACAGCTTCCACGGGCGCCGGTACCTGCGCGAGCACGAGCAGATGTACTGGATCCAGTGGCACATGGCCAAGATG
AGGGCGGACCAGACGGCGGACACGGGGTCCAGGAACGCCTTCAAGTTTGGCTCTCGGCCGCCGCTCAAGTACACG
GAGTCGGACTCGTTCGGAGAGGACGAGGCGGCCAAGGTGGCAGAGGAGGAGGAGGAGGAGGAGGAGGAGGGGGAG
GAGGGGAAGGAGGGGGAGGAGAGAAGACCTGGTCGGGCCGACGGAGCAGAAGCGGAAGAGAGGATGACGTTGGTA
TCGTCGCCCACGGGCAGTGTCGACTCGGAAGCGCAGACGGCGCGGAAGTCGAACTCCAGGTCGGGCCTGTCGAGG
CTCTTGCGAGGACCGAGCGGCATCGGCCTCGGCCGGCACCATCACCACAGCAGGCACGTGCCGTATAGCCCGGGA
GGCTCGACGGCGGCGAGCAGCTTCAGCAACTGGGCGCCGGGATAG
Gene >Hirsu2|7894
CTGGGCGCCGCCAGCCCGCCCAAGAAGGGCCTCGGTTGCGTCGATCTCGCATCGCTCGGTTCCAGGGCACTCGAG
GATGACCGCCTGACTGAGACGGCACAGCTTCTCGCCGGAGCTTGCGTTGACAAGAATCTCTCCGGTCTCGCTTTC
CGGCTCTCGTCCTCGCTGCAGTCCAAGAAGGTCGAGAAGCTGATGCAAAGGCTCTCATCCAACGACTTCCCGGCC
CTAGTCTTCCTCCATCACGACTCAACAACGCTCGACTCTCTCAGCCTCGAGCACGCTGCCGGCGTCGTCATCCAG
AATGCTGTGATCCTCCCCAACGGCCAACGCCGAGACTACTTTCAAGCTCAGGGACTTCGCAGCATCATGGCCAGA
AGCGTCAAGGAGCGTGAGAGAAAGCCCGAGTTCTTCATCGGTTTCCTCGAGCTATGGGAGCTCCAGCCGCATCCT
GCCGTCATCCGTCGTGCCGTCAAGTTGGCCGAGCATTTTGGCGCCGCTGTGCAGCACGCCCCTTCGAGCCCGTCC
CTGGGTCCCGAGAGGCGCTTAGTCGGAGCAGATCGCACCTTGAGCGCCTTTGAGTATTTAAAGCGACCGGATCTG
ACAAAGGTGAGTAAATCTTCAGCTGGCTTCTCCCCCCCTTTCCCGCCTAGTCATCTGACAGATCTTTAGCTGCAA
CAATACTGGACGAAAGAGCAGCGAAAAATCTGGATTCCAAACGGTAAACAAGCCCCAGAGATGAGGTCGCTGAAT
GTCGAGCTTCTGGGCACGGTGGTCCCATCCGTACCCAATCTTTTGCTTCCTGAGGCTCTACCACCATCGCTCAGC
AAGTTGCAGTCGGAGCTCCCGGCCTTGTATGAGCCGCCCGACTACGCGTCAAAAGTGCCCTTGCGCGAAGACTTT
TGGCACTCTTCACGCGATGGAAACATCATGGCGCCGCTGGGGTGCTACTCAATCTGCTCCGAACCGTCGCCGGAA
GATTATGCATCTGTCGTGCAGACTCAGCAGCATCTCAAACAACTCGACCTGCTGCACTACATGAAGGGTGTTGCG
TCCTTCAGGCTGCTGGAGGCCCTGCGAACGCTGGCTTCTCGGGAGCAGTGCGGTCACTTGGTCCAAGACTTGATC
GATGGCCTGGAATCTCAACAGATCTGCGTCTACAAGGGCCTAGACACGGGCTTTCGGATTCCTGACGGGGAGGCC
TGCTTCTGGGGAGTGTCACGCGCCCGGGACGATAGGACGAGGCTCTCTGTAGACATATTCATCTCCCAAAAGGCG
CCGAACAACGCGACGACAATTCTTCACACGTGGCTGGCTCATAACGGAGTGCCCCGCGACGTACGATATGACCTC
GAAGTTCTGCTCGAGGCCGCCAGTGGCATCGACGACGCGGCAAACGGCTTACCCCTGAGCATCCGGACTGGAATC
GAGCAAGCCACTAACGCAGAGACGCTGCAGCTGCTGCAGCAGATGCAGGCGACGCGGCTCGAAGGCCATCTCAAA
GGCTCCATGGTCAAGTTTTGCAGGCTGAAGCTCATAAATCGGACAACAACCAAGTCCCGGACACGGACGTACGGC
CGTGGACTGCTGGATGGCTCCATGACCATGCGTGAGGCACTGGAGATTCGACTCGAAACTTTGGCGCAGCTCGGC
GCAGCTCGGCTGCCACTTCTGGAGAAACTGTTAGAGCTGCACGACCTCGTTGATGGGACCGTTCGCGATGCCCTT
TTCTTCGGCGACAAGGATCGCCTGAACGCCCTGGCAGCATCCCTGGCTCAGGCATTTGATATGCCTTCGTCGGAT
CCTGACAGCTATGTGGACGTCAACACCGATCTCTTCGCCCTCATCTTCTTCAGCGTATTGAGGAAGGCCGCTTTC
GAAGACGTCTACATCGAGGCTACGGACCGCTGCCCCCTCTTCCTTCAGCCTGACCAGGCGGCCGTCTTCTCGGAG
CTGTGGGTACTCGGGTCGCAGTGCGAAGCCTACTTCGGGATCCTGCCCCGGGACTTGGGCGAAATCATATACGAT
CGCTACCGCTTGTTCCTGGAGGAACGGGCACCTAGTGCCGCCGACCGTACTGGCAACGAAATCATGACCATGTAC
TCGAGCTCCGAGTCGAGCCCGCAAGCCGTCGCTGCCAAAAGCAGCAAATGGAGAGCCACCCTGGGCGGACAGACG
ACCATGTTTGAGAAGCTTGAACAATGGAAGACGCGCTTCGCCGAGTTCGGCGCCATGTCAATCTTCTGTCTGCCT
GCCATCATCGACGTCGTGTTGCTAACGTTCCTCGGCCGCGGCATGTTCATGACGGCCTTTATGCACCCGGACCAC
CTTCGGGCCGCCGTCTATGCCCTCCTCATCTCCCTTCTGCTGTCCGCTGGCGTGGTCGGTTGGGTTGGCAGCTCT
GGCAACTACTACCTGGCTCATTACGCTTATGACAACATGATTTACTTTCATGTCCAGCGGCTCTCTGGCGGCTTC
GTCCTTGTCCTCGTCGTTGCCGCTGCCGGCCTCATTGGCTTTTCTGTGGCAAGTTCTGTTGCCGTTGGCTTCGTC
TTCGTCGCCTTCCTCATCGCCATCACCACCTATCTTAATCTTCTCGGCATTCTCGCAACGATGCATCAGCAGAAT
AGTCCCATGACGTCAGGTCGCACCGTCGTCTGGCGAAACATCCCTCTGCTCTTGCTGTCGCCCGCCATTTCATGC
TTCGTGAACGGCCACGACCTCGAGATATACCTGCCCACCATATACTGCTTCCTCCTGCTCCTGACATATCAGTAC
CGACAGCTTTGCCACGAGTGGTCCGGGTGGATGCGCAACATTCCGGACTTCTCTGACAAGGACGTCCTGGAATGG
TACGTGGCCAAGTGTCAGCCGGACGCGGACTCTACGGAGGGGTCGCAAGTCAGTGGCAAGGATGCACAGGAGGCT
TTTCGCGAGGCTGTCTCGTCTTACCGCAGACGGACTCGGGGAGCAGCATCATCCGGAGTTCTAAGAGATGCCTTT
GTTGGCCGCGTGTCCAAGAGCATGCCGTACGTCGACTGGCTGTTCAAAAAGGCGGCCCCGGACGGCAACGTACCG
CCGGCGTTCAGCAATGGCTGGTTCACACAACTAGGCGACGCAAAGAAGCAGCAGCAGCAGCTCGCGCGTGGACTC
AAGGAGCACAACATCTTCATGCTTTTCCGCATGGCTCGCTACGACATCGGGCAGAACTTGGGCTTGTTTCTCGTC
GCCCTCATGGACCGCTGGGTCAGCGTCGTCATGTCAGCGAGGGAGCCGCATGCCAGCATCTACACCGACTCCCGC
GCCCGGTATGGCATTTGTTTTTGCATCCTGTATTTCAGCTTTTCCGTCATGATTCTCGACCTCGTCCTGCAGAAG
TACTGGAGTTTGCGCTTCACATCGTCCAAGGAGCCGCTCGTCGACTTCAACCATGCGCGAATGGTGGCCATGGAC
TGGGAGAGGATGCGGCGGAGAACATTGACCGGGGCCTTGATCGAGCTTTTCAGAAAGATCATAATCGTCTTCGGC
GCCACCACCATCTTTCTCTGGCTCTTCGTGGAAAGCAACGAAACCATGACGCTCTATTACATGTACGTCCTCGGG
TACACGTGTGTTATCATCTTCCAATTCAACCGCTGCTTCACGACAAATGTCAGCGCCCACGTCACAATCATCTTC
GTGTCGGCAATCTGCGGCTTCGTTCTTGGATGTGTTCTTCACGCCGTTCCCGCCACGGCGGGCTGGCTCTACTCG
GATATCATAGCCCAGAACTGCGCTGCCGTGCTGGCGGCGATTGGAACGCTCGCCTGGTCGTGGAGCGATTTTTCC
ACTCCAAGAGATACAAAGCTGGCACACCAGAGCTCCGCCAAGTCGACGCGGGCTCGAAGGCTCTGGGCCCAGAGG
AAAATTATGGCAGAGGGCGACGCCGAGACGAGAATACCGCTGGTCAAGTTCAGGAAGATGGACGGCATAGTCTAC
TCGCACGAAGACGGCTCCATCGTTTCGCAGACCATTGTGCAGCTCCTTCGCAAAAGCCTCAGCCTGCGAAACAAC
ACGGCCAGAAACTCATCTTGGTCGACTGACCTCATGGATACCGTCATGAGGATGTGGTCAGCACGCCGTGCCCGA
ATCGTGGCTGTCGACTGTGACGCCTTTTCCGCTGCCGGCCTGGACGGCATTTGCTCGGTCAGTCAGATGGGCGAT
GGTGGAATCCTGACCATCAAGATCGGCCTGTTCGGAGAGACGGAGCTTCGCTTGCCCTCGTGGCAGTCTCTGCTG
GGCACCGTGTCTGCCGAATGTCTGCTTTATCACGTGGCCCGCGTCGAGTTCAACCGTTCCCACGCCCAAGCGGTG
CAAGCAGAGCACTTCCTGAACAGGACAACTGACATGTCCAAACGCATCGAGCTCGAGCTGGCCACCGGCGGCTCG
CAAGACTTGAAGCGCGTTATTAGCAAGACGACTGCCGAGCTCATGCGCCATCTGTGTTGGAACGTCGACGTACAG
GCAGACTGGCAGACCGTTCCTCAATGCGGCCGAGAGGCCATATTTTGCCGCATCGCCGGCCAGCCTGTTTCTTTC
ACCGAGGAGCTCTCTCGGTGGATTTCTCGAGAGCGAATCGACTTACACGCTGTAGACTTCCATCTCAATCTCTGT
CTCTGCATCTTCCACGACTGCAACGAGCGATTACTGTCGACCGTTGTCTTTCCCGGCGGCGATCAAGCCGAGGTC
TTCAAGCACGCCGCCCAGCTGAAACCGGCTCGAGTCTACAACTTACGAGCACCGACGAACTTGCTGCAACGTTTC
TTTCGTGCCTTCACTGCGGTCCCTCTCTCGGTCGTCAAATGGATAGCCATCATTTCTGGCGGAGGATCCAACATT
GAACGAGAGCTCTGGTACGGCCTGCGGAATGTGTTCTGCGGCCATATGATTTTGCGAGCCACTCTGGCAGTCTGG
AGGCTGTGCAGGGCATTGAAAGAGCTTCTCATGCATGCGCTGCTGATTTATCATCGTCACTCCCTCGTCAATATC
ACTCGGCTAGCGCAGAAGGGAGAGCGGCGCAAGATCAAACGAAACGCTATCGTGGTCGATTGGGCCCGCAAGCCC
ATCACGGCTTTCGCCAGCAGTGGCCTCGACGAGAGGACACACATGACTGTTGAGGCATTCGACGGGCCTCAGCAG
AGTCCCCCACCAGACAAGTCGTTTGCATTCAAAGCAAACTACGACGAGCACTTCCGCCTTGTCAGCAGAGAAGAC
AGAAACGACAAGACAACGTCAATCTACAATTACAGCTCCCGAGGTCACGATCGGTGGCCGCAGTCCAAGGAAGTC
GTGGGCGAAAAGCACTGGTTGATCGGCATTTACGACAGCTGCGGCCGCATCAAGCATGGCATCATGACATTGAGC
GACTCTTCGAGGCTCAACTTCTGTTACCATTACAAGGCAACCCCCAAGGGCAACTCCATCATTCTGGCGGCAGAT
TTCGTACCCGTCGTCAAGTCCGGGCCCGTGGACAAGCTGTCCGTCTACTGGGGACCTCCCCGCAGGGACGCGACG
AACAGCTATGACTGGGTCCCATCGGACAAGGTCTATCGCATTGTCAGGATCATCAACGGCAGGAGGTTTGTTACC
GAGCTGGAGTACAACCATCGCCGGGACCCCGTCAGCACAACGATTGTTGAAGAGGAAAACGAGCTGAAAACGGCA
GTGGCCGAGGTTCCCAAGCTTCCCTTTGAGGAGGATTCGTTGTTCAAGAAGCCGGTGAATCTCTCGTTTGCCTAC
GATGACATCCTCATCCACCACAACATCCTCCAGCTGAGGCGCCTGAGGCAGTACGCCGTCAACACGCTGTCCATC
GTGTCGCGCTGGAGTCCCTTGCACCTTTGGAAAAGGAAGGTGTATCTGTCTGTCCCAACGTGGCGCATCCGCACC
GAGCTATGGAATAGCTGGCTGAATGACAGCTTGGATGCCGCGACTGTCTGCTGGATGGACGAGCTCATTCTTCGC
GAAGAGCCGCTGCTGCGCAAGTACTGGCGTGCCCGCGAAAGCGGGCGGCTGGAAGACGCGAGGCGGGCATTGGAC
GGAGACATCAACCAGATTGTGTCCGCCATCGAGCTGGAGACGGACATCTCGGAGCTTTGCCTGCTCCCCATCCGG
ACTTCGGACCTTTACGCCATGGGCTTGGGCAGAGATGCGACCGAAGTCACGAACCGGCCACAGGACTGCTACAAG
GACACGGAGGACCGCCTGTCCGTCATCGTCAACGATATCGGATGCTGGCCCGAGGCGCCCGGGGGGGTGTCCAAC
TGCAGGAGAGACCTGGTCAACGGGCACAGCACGATCCGCAACCACGTCTTGGCGGAGTGCGCCCACGACTTTGGC
ATCCCGAGGTTCCAGGTCGAGAAGAGCGTGCAGTCGCTCAAGCTGCTGCCCCTCTGGGGTCTCGACGGCAAGACG
GCCTATCACGGGCTCATGGAGAATATCCTGCAATCGCAGGTGGACGAGAAAATCCGCGACACAGACCTTCAGAGA
GACATCATCGGGGTCTTCATCCCACTCCTCAAAGACTTCGTCAGGGGGGCCCGTACCAAGAGCTACTCCCACGCG
GACCTGGTCAGGTACACCAACGTCTTCCTCTCCATGTCCAAGTACTACGAGCACAAGGACTACAACCAAACGTGG
AGCTCCAAGGCAGTCGAGGACGCGTGGGCCGAGGCCTGGCTCGTGCCGTACAAGGATGCCAACATCACCGATCCG
GCCGAGCACTTTGACATGCAGAGGCCCAGCATGGCCGACTTCAAGGACGCGCTGGGCATCTACCTTGCCTATTTC
TTCATCTTCTCCGTCAGGATCCCCGAGGAGTGCCCGCGCGTGTTCCAGAGCACCCACCACGGCATCAGCAGCCTC
TTTGGCATGCTGCTCAAATACCGCCGCGGCGTGACGTTTGGCATCTGGGACCACGCCATTCTGTGGCGGGAGAGT
TGCCTCAACATCAGCCCGGCCCAGTGCGAGCTGTCGGTGCCGGTGCAGTCGATGCTCCTGGCGGGGATCCGCCTG
GCCAGCCGCCTGGCCTACCTGCACGCCGACATTGTCGTGCCGTGCACGTCGCTGTTCAACCCGTGGGTGCCTCCT
CATCTTCCCCCCCGCGACTTGTCGACCGTCTGCCGCTGTCGACGTGCGACAGTCTTTTGCTGACCGGCCCCGGCC
TCGTAGAATGTGGGAAACAGAAATCGGGACGGACAAGGGCAAGATTTGCAGCAAGAACGAGTTCCGGCGCAAGAT
CGACCCCATCGTCAACGGCATCAGCAACATGGAGTCGTTCACGCCGGTCGACAAGGTGCGGACGGACAAGCCGAC
GGTGGTGATGCTGTCGAACGTGCAGTTCATCAAGGGCATCAAGCCGGCGATCCTGGCGGCCGACATCATCGTCAA
CCGCTACGGGTTCCGCGACTACAGGCTGTTGATCTACGGGGCCAAGGATCGCCAGCCGTCGTACGCGCTCGAGAT
GGCCAAGCTGATTGTCAAGTGCAACCTGTCGGAGAACGTGGTCCTGGCCGGGTTCGGCAAGCCCAAGGAGGTGCT
GCAGGACGCCTGGCTCTTCGTCAACTCGTCCATCTCGGAAGGGCTGCCGCTGGCCATCGGAGAGGCGGCGCTGGC
GGGCGTCCCCATCGTCGCGACCGAAGTGGGAGCCACGGCGCTGGTGGTGACGGACCCGGACGACCAAGGGCAGAG
GTACGGCGAGGTGGTGGCGCCCAACGACCCGATTGCCCTCGCGCGGGCGCAGCTGAGCCTGCTCTGCATGGTCGG
CCCCTGGGCGCGCTTCACGCAGGACGGCGAGAAGGGCGAGGTTGGGGGGCTGCCGGAAGAGATGAGGCCGGAAGA
CGTCGAGTGGCTCTGTCGACGGATGTACGAGAAGAGCGAGGACCGGAGGCGGCTCGGCCTGCTGTCACGCGAGGT
GGTGCTGCACAGCTTCCACGGGCGCCGGTACCTGCGCGAGCACGAGCAGATGTACTGGATCCAGTGGCACATGGC
CAAGATGAGGGCGGACCAGACGGCGGACACGGGGTCCAGGAACGCCTTCAAGTTTGGCTCTCGGCCGCCGCTCAA
GTACACGGAGTCGGACTCGTTCGGAGAGGACGAGGCGGCCAAGGTGGCAGAGGAGGAGGAGGAGGAGGAGGAGGA
GGGGGAGGAGGGGAAGGAGGGGGAGGAGAGAAGACCTGGTCGGGCCGACGGAGCAGAAGCGGAAGAGAGGATGAC
GTTGGTATCGTCGCCCACGGGCAGTGTCGACTCGGAAGCGCAGACGGCGCGGAAGTCGAACTCCAGGTCGGGCCT
GTCGAGGCTCTTGCGAGGACCGAGCGGCATCGGCCTCGGCCGGCACCATCACCACAGCAGGCACGTGCCGTATAG
CCCGGGAGGCTCGACGGCGGCGAGCAGCTTCAGCAACTGGGCGCCGGGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail