Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7893
Gene name
LocationContig_486:2481..3690
Strand-
Gene length (bp)1209
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 2.5E-36 10 330
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 2.0E-06 11 59
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 8.5E-25 117 391
PF07993 NAD_binding_4 Male sterility protein 8.7E-06 119 235

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SN58|UGE5_ARATH UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana GN=UGE5 PE=1 SV=3 10 399 7.0E-90
sp|Q9T0A7|UGE2_ARATH UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana GN=UGE2 PE=1 SV=1 8 399 1.0E-89
sp|Q9C7W7|UGE4_ARATH UDP-glucose 4-epimerase 4 OS=Arabidopsis thaliana GN=UGE4 PE=1 SV=1 10 400 2.0E-88
sp|Q8R059|GALE_MOUSE UDP-glucose 4-epimerase OS=Mus musculus GN=Gale PE=1 SV=1 10 396 2.0E-86
sp|Q3T105|GALE_BOVIN UDP-glucose 4-epimerase OS=Bos taurus GN=GALE PE=2 SV=2 10 396 8.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SN58|UGE5_ARATH UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana GN=UGE5 PE=1 SV=3 10 399 7.0E-90
sp|Q9T0A7|UGE2_ARATH UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana GN=UGE2 PE=1 SV=1 8 399 1.0E-89
sp|Q9C7W7|UGE4_ARATH UDP-glucose 4-epimerase 4 OS=Arabidopsis thaliana GN=UGE4 PE=1 SV=1 10 400 2.0E-88
sp|Q8R059|GALE_MOUSE UDP-glucose 4-epimerase OS=Mus musculus GN=Gale PE=1 SV=1 10 396 2.0E-86
sp|Q3T105|GALE_BOVIN UDP-glucose 4-epimerase OS=Bos taurus GN=GALE PE=2 SV=2 10 396 8.0E-86
sp|Q5R8D0|GALE_PONAB UDP-glucose 4-epimerase OS=Pongo abelii GN=GALE PE=2 SV=1 10 396 1.0E-84
sp|Q14376|GALE_HUMAN UDP-glucose 4-epimerase OS=Homo sapiens GN=GALE PE=1 SV=2 10 396 1.0E-84
sp|Q9W0P5|GALE_DROME UDP-glucose 4-epimerase OS=Drosophila melanogaster GN=Gale PE=1 SV=1 10 400 1.0E-83
sp|Q42605|UGE1_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Arabidopsis thaliana GN=UGE1 PE=1 SV=2 1 398 2.0E-83
sp|Q8LDN8|UGE3_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3 OS=Arabidopsis thaliana GN=UGE3 PE=1 SV=1 1 399 2.0E-83
sp|P55180|GALE_BACSU UDP-glucose 4-epimerase OS=Bacillus subtilis (strain 168) GN=galE PE=3 SV=1 10 401 4.0E-82
sp|P18645|GALE_RAT UDP-glucose 4-epimerase OS=Rattus norvegicus GN=Gale PE=2 SV=1 10 396 8.0E-82
sp|O65780|GALE1_CYATE UDP-glucose 4-epimerase GEPI42 OS=Cyamopsis tetragonoloba PE=2 SV=1 10 400 3.0E-81
sp|O65781|GALE2_CYATE UDP-glucose 4-epimerase GEPI48 OS=Cyamopsis tetragonoloba PE=2 SV=1 6 399 6.0E-81
sp|Q6ZDJ7|UGE2_ORYSJ UDP-glucose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UGE-2 PE=2 SV=1 5 400 8.0E-81
sp|B0M3E8|UGE1_PEA Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Pisum sativum GN=UGE1 PE=1 SV=2 6 396 1.0E-80
sp|P24325|GALE_HAEIN UDP-glucose 4-epimerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=galE PE=3 SV=2 10 396 5.0E-80
sp|Q8LNZ3|UGE1_ORYSJ UDP-glucose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UGE-1 PE=2 SV=1 10 400 6.0E-80
sp|Q43070|GALE1_PEA UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE PE=2 SV=1 6 396 1.0E-79
sp|P04397|GAL10_YEAST Bifunctional protein GAL10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL10 PE=1 SV=2 1 399 2.0E-79
sp|Q553X7|GALE_DICDI UDP-glucose 4-epimerase OS=Dictyostelium discoideum GN=galE PE=1 SV=1 10 398 5.0E-79
sp|Q6K2E1|UGE4_ORYSJ UDP-glucose 4-epimerase 4 OS=Oryza sativa subsp. japonica GN=UGE-4 PE=2 SV=1 6 400 2.0E-78
sp|Q9HDU3|GAL10_SCHPO Bifunctional protein gal10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal10 PE=3 SV=1 8 397 2.0E-78
sp|Q57301|GALE_YEREN UDP-glucose 4-epimerase OS=Yersinia enterocolitica GN=galE PE=3 SV=1 10 396 5.0E-78
sp|Q9CNY5|GALE_PASMU UDP-glucose 4-epimerase OS=Pasteurella multocida (strain Pm70) GN=galE PE=3 SV=1 10 399 3.0E-77
sp|P56986|GALE_NEIMC UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup C GN=galE PE=3 SV=1 8 400 3.0E-77
sp|Q9Y7X5|UGE1_SCHPO UDP-glucose 4-epimerase uge1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uge1 PE=1 SV=1 10 399 4.0E-77
sp|Q9F7D4|GALE_YERPE UDP-glucose 4-epimerase OS=Yersinia pestis GN=galE PE=3 SV=1 9 400 5.0E-77
sp|E8MF10|GALE_BIFL2 UDP-glucose 4-epimerase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) GN=lnpD PE=1 SV=1 10 390 6.0E-77
sp|P56997|GALE_NEIMA UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=galE PE=3 SV=1 8 400 7.0E-77
sp|P22715|GALE_SALTY UDP-glucose 4-epimerase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galE PE=3 SV=2 10 400 9.0E-77
sp|Q652A8|UGE3_ORYSJ UDP-glucose 4-epimerase 3 OS=Oryza sativa subsp. japonica GN=UGE-3 PE=2 SV=1 3 399 1.0E-76
sp|P56985|GALE_NEIMB UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup B (strain MC58) GN=galE PE=3 SV=1 8 400 2.0E-76
sp|Q56093|GALE_SALTI UDP-glucose 4-epimerase OS=Salmonella typhi GN=galE PE=3 SV=2 10 400 2.0E-76
sp|P09147|GALE_ECOLI UDP-glucose 4-epimerase OS=Escherichia coli (strain K12) GN=galE PE=1 SV=1 10 400 4.0E-76
sp|Q05026|GALE_NEIGO UDP-glucose 4-epimerase OS=Neisseria gonorrhoeae GN=galE PE=3 SV=1 10 400 4.0E-75
sp|Q59678|GALE_MANHA UDP-glucose 4-epimerase OS=Mannheimia haemolytica GN=galE PE=3 SV=1 10 396 3.0E-72
sp|P35673|GALE_ERWAM UDP-glucose 4-epimerase OS=Erwinia amylovora GN=galE PE=3 SV=1 10 399 4.0E-72
sp|P09609|GAL10_KLULA Bifunctional protein GAL10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL10 PE=2 SV=2 8 397 1.0E-68
sp|P40801|GAL10_PACTA Bifunctional protein GAL10 OS=Pachysolen tannophilus GN=GAL10 PE=2 SV=1 9 400 1.0E-67
sp|O84903|GALE_LACCA UDP-glucose 4-epimerase OS=Lactobacillus casei GN=galE PE=3 SV=1 10 396 5.0E-50
sp|Q59745|EXOB_RHILT UDP-glucose 4-epimerase OS=Rhizobium leguminosarum bv. trifolii GN=exoB PE=3 SV=1 10 399 8.0E-49
sp|Q9KDV3|GALE_BACHD UDP-glucose 4-epimerase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=galE PE=3 SV=1 10 396 8.0E-48
sp|P26503|EXOB_RHIME UDP-glucose 4-epimerase OS=Rhizobium meliloti (strain 1021) GN=exoB PE=3 SV=1 10 399 4.0E-47
sp|Q45291|GALE_CORGL UDP-glucose 4-epimerase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=galE PE=3 SV=2 102 398 1.0E-46
sp|P33119|GALE_CORDI UDP-glucose 4-epimerase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=galE PE=3 SV=2 10 399 3.0E-45
sp|P96995|GALE_STRMU UDP-glucose 4-epimerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=galE PE=3 SV=2 10 398 4.0E-43
sp|Q7WTB1|GALE_LACHE UDP-glucose 4-epimerase OS=Lactobacillus helveticus GN=galE PE=2 SV=1 10 396 1.0E-41
sp|P21977|GALE_STRTR UDP-glucose 4-epimerase OS=Streptococcus thermophilus GN=galE PE=3 SV=1 10 398 2.0E-40
sp|Q59083|EXOB_AZOBR UDP-glucose 4-epimerase OS=Azospirillum brasilense GN=exoB PE=3 SV=1 2 384 2.0E-39
sp|Q8H930|ARAE1_ORYSJ Probable UDP-arabinose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UEL-1 PE=2 SV=2 10 385 2.0E-38
sp|Q9SA77|ARAE1_ARATH UDP-arabinose 4-epimerase 1 OS=Arabidopsis thaliana GN=MUR4 PE=1 SV=1 10 396 9.0E-38
sp|O64749|ARAE2_ARATH Putative UDP-arabinose 4-epimerase 2 OS=Arabidopsis thaliana GN=At2g34850 PE=2 SV=3 10 396 2.0E-37
sp|Q8H0B6|ARAE2_ORYSJ Probable UDP-arabinose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UEL-2 PE=2 SV=1 10 383 2.0E-37
sp|Q8H0B2|ARAE3_ORYSJ Probable UDP-arabinose 4-epimerase 3 OS=Oryza sativa subsp. japonica GN=UEL-3 PE=2 SV=1 10 396 3.0E-37
sp|Q9FI17|ARAE4_ARATH Putative UDP-arabinose 4-epimerase 4 OS=Arabidopsis thaliana GN=At5g44480 PE=3 SV=1 10 396 9.0E-36
sp|Q9SUN3|ARAE3_ARATH Probable UDP-arabinose 4-epimerase 3 OS=Arabidopsis thaliana GN=At4g20460 PE=2 SV=3 10 396 3.0E-34
sp|P13226|GALE_STRLI UDP-glucose 4-epimerase OS=Streptomyces lividans GN=galE PE=3 SV=2 11 400 1.0E-32
sp|P75517|GALE_MYCPN UDP-glucose 4-epimerase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=galE PE=3 SV=1 124 392 5.0E-28
sp|P47364|GALE_MYCGE UDP-glucose 4-epimerase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=galE PE=3 SV=1 124 392 2.0E-26
sp|P56600|GAL10_CANMA Bifunctional protein GAL10 (Fragment) OS=Candida maltosa GN=GAL10 PE=3 SV=1 6 176 3.0E-22
sp|P45602|GALE_KLEPN UDP-glucose 4-epimerase (Fragment) OS=Klebsiella pneumoniae GN=galE PE=3 SV=1 10 178 2.0E-20
sp|Q9LPC1|GAE2_ARATH UDP-glucuronate 4-epimerase 2 OS=Arabidopsis thaliana GN=GAE2 PE=2 SV=1 10 380 5.0E-14
sp|O81312|GAE3_ARATH UDP-glucuronate 4-epimerase 3 OS=Arabidopsis thaliana GN=GAE3 PE=2 SV=1 10 380 1.0E-13
sp|O22141|GAE4_ARATH UDP-glucuronate 4-epimerase 4 OS=Arabidopsis thaliana GN=GAE4 PE=1 SV=1 10 380 1.0E-13
sp|Q9LIS3|GAE6_ARATH UDP-glucuronate 4-epimerase 6 OS=Arabidopsis thaliana GN=GAE6 PE=1 SV=1 10 397 2.0E-12
sp|Q9STI6|GAE5_ARATH UDP-glucuronate 4-epimerase 5 OS=Arabidopsis thaliana GN=GAE5 PE=2 SV=1 10 380 2.0E-10
sp|Q2SYH7|WBIB_BURTA dTDP-L-rhamnose 4-epimerase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=wbiB PE=1 SV=1 8 401 2.0E-09
sp|Q7BJX9|GNE_PLESH UDP-N-acetylglucosamine 4-epimerase OS=Plesiomonas shigelloides GN=wbgU PE=1 SV=1 104 339 1.0E-08
sp|P14169|RFBE_SALTI CDP-paratose 2-epimerase OS=Salmonella typhi GN=rfbE PE=1 SV=2 10 330 7.0E-08
sp|O34886|YTCB_BACSU Uncharacterized UDP-glucose epimerase YtcB OS=Bacillus subtilis (strain 168) GN=ytcB PE=3 SV=1 124 386 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7893
LEQNGSRKFILVIGGLGFIGSHTSLELLKAGYNVVIVDNLSNSFESVFSRIRMLAAEHHRGSGGDMPALHLHKIA
YQSESMQFLLDMYSVPAGCKRQRRGPEVVPADGREGSAGATRQSRISGVIHFAASKSVSESISRPIQYYRNNVCG
LVDLVELLGQYNIRNLVFSSSATVYGSKADKGRPLREEDLVHETETYVDGDGKAAVAEPAVAGLQSPYARTKYFC
EAILADIARSDPAWRIVCLRYFNPVGCDSSGQLGEDPKGTPTNLFPVMTQVLTGAIQELSIFGSDWGTRDGTAVR
DFVHVSDVARGHIAALASEAEAPFRTYNLGSGTGTTVVEAVQSLEAAARRPIPVSRVGRRVGDVGFCVASNERAA
QELGWAAQESIPKCAEDLWRFVSKEVV*
Coding >Hirsu2|7893
CTGGAACAGAACGGAAGCAGGAAGTTCATTCTCGTTATTGGCGGCCTGGGCTTTATCGGATCACACACATCGCTC
GAGCTGCTCAAGGCTGGATACAATGTCGTCATCGTCGACAACCTCAGCAACAGCTTCGAGTCTGTCTTTTCTCGC
ATCAGGATGCTTGCTGCCGAGCATCACCGGGGCAGCGGCGGCGACATGCCCGCCCTTCACCTGCACAAGATCGCC
TACCAGAGCGAAAGCATGCAGTTCCTGCTCGACATGTACTCGGTTCCCGCCGGATGCAAGCGGCAGCGAAGAGGT
CCGGAAGTCGTGCCGGCGGACGGGAGGGAAGGCTCGGCAGGCGCAACAAGACAGTCTCGGATCAGCGGCGTCATT
CACTTCGCCGCCTCCAAGTCGGTCTCTGAGTCCATCTCACGGCCAATCCAGTACTACCGAAACAACGTGTGCGGA
CTGGTAGACTTGGTCGAGCTTCTCGGCCAGTACAACATCCGGAACCTGGTCTTCTCGTCCTCGGCCACCGTGTAC
GGCTCCAAGGCGGACAAGGGCCGACCGCTGCGGGAAGAGGACCTCGTGCACGAGACGGAGACGTACGTCGACGGC
GACGGCAAGGCGGCCGTGGCCGAGCCCGCAGTGGCCGGGCTGCAGAGCCCGTACGCGCGGACCAAATACTTCTGC
GAGGCCATCCTGGCCGACATTGCGCGGTCAGACCCGGCATGGCGCATCGTCTGTCTGCGCTACTTCAATCCGGTC
GGCTGCGACTCGTCGGGCCAGCTGGGCGAGGACCCCAAGGGGACCCCGACCAACCTGTTCCCCGTCATGACGCAG
GTGCTGACGGGCGCCATCCAGGAGCTCAGCATCTTCGGCAGCGACTGGGGCACGCGGGATGGAACGGCGGTGCGC
GACTTCGTGCACGTGTCCGACGTGGCCCGCGGGCACATTGCAGCCCTGGCGTCCGAGGCCGAGGCGCCCTTCCGA
ACCTACAACCTGGGCTCGGGCACGGGGACGACGGTGGTGGAGGCGGTGCAGAGCCTCGAGGCGGCGGCTCGCCGG
CCCATCCCCGTGAGCCGCGTTGGTCGTCGGGTGGGCGACGTTGGCTTCTGCGTTGCGTCCAACGAACGTGCGGCG
CAAGAGCTCGGCTGGGCAGCCCAGGAGAGCATACCCAAGTGCGCCGAGGACCTGTGGAGGTTTGTGTCCAAGGAA
GTGGTCTGA
Transcript >Hirsu2|7893
CTGGAACAGAACGGAAGCAGGAAGTTCATTCTCGTTATTGGCGGCCTGGGCTTTATCGGATCACACACATCGCTC
GAGCTGCTCAAGGCTGGATACAATGTCGTCATCGTCGACAACCTCAGCAACAGCTTCGAGTCTGTCTTTTCTCGC
ATCAGGATGCTTGCTGCCGAGCATCACCGGGGCAGCGGCGGCGACATGCCCGCCCTTCACCTGCACAAGATCGCC
TACCAGAGCGAAAGCATGCAGTTCCTGCTCGACATGTACTCGGTTCCCGCCGGATGCAAGCGGCAGCGAAGAGGT
CCGGAAGTCGTGCCGGCGGACGGGAGGGAAGGCTCGGCAGGCGCAACAAGACAGTCTCGGATCAGCGGCGTCATT
CACTTCGCCGCCTCCAAGTCGGTCTCTGAGTCCATCTCACGGCCAATCCAGTACTACCGAAACAACGTGTGCGGA
CTGGTAGACTTGGTCGAGCTTCTCGGCCAGTACAACATCCGGAACCTGGTCTTCTCGTCCTCGGCCACCGTGTAC
GGCTCCAAGGCGGACAAGGGCCGACCGCTGCGGGAAGAGGACCTCGTGCACGAGACGGAGACGTACGTCGACGGC
GACGGCAAGGCGGCCGTGGCCGAGCCCGCAGTGGCCGGGCTGCAGAGCCCGTACGCGCGGACCAAATACTTCTGC
GAGGCCATCCTGGCCGACATTGCGCGGTCAGACCCGGCATGGCGCATCGTCTGTCTGCGCTACTTCAATCCGGTC
GGCTGCGACTCGTCGGGCCAGCTGGGCGAGGACCCCAAGGGGACCCCGACCAACCTGTTCCCCGTCATGACGCAG
GTGCTGACGGGCGCCATCCAGGAGCTCAGCATCTTCGGCAGCGACTGGGGCACGCGGGATGGAACGGCGGTGCGC
GACTTCGTGCACGTGTCCGACGTGGCCCGCGGGCACATTGCAGCCCTGGCGTCCGAGGCCGAGGCGCCCTTCCGA
ACCTACAACCTGGGCTCGGGCACGGGGACGACGGTGGTGGAGGCGGTGCAGAGCCTCGAGGCGGCGGCTCGCCGG
CCCATCCCCGTGAGCCGCGTTGGTCGTCGGGTGGGCGACGTTGGCTTCTGCGTTGCGTCCAACGAACGTGCGGCG
CAAGAGCTCGGCTGGGCAGCCCAGGAGAGCATACCCAAGTGCGCCGAGGACCTGTGGAGGTTTGTGTCCAAGGAA
GTGGTCTGA
Gene >Hirsu2|7893
CTGGAACAGAACGGAAGCAGGAAGTTCATTCTCGTTATTGGCGGCCTGGGCTTTATCGGATCACACACATCGCTC
GAGCTGCTCAAGGCTGGATACAATGTCGTCATCGTCGACAACCTCAGCAACAGCTTCGAGTCTGTCTTTTCTCGC
ATCAGGATGCTTGCTGCCGAGCATCACCGGGGCAGCGGCGGCGACATGCCCGCCCTTCACCTGCACAAGATCGCC
TACCAGAGCGAAAGCATGCAGTTCCTGCTCGACATGTACTCGGTTCCCGCCGGATGCAAGCGGCAGCGAAGAGGT
CCGGAAGTCGTGCCGGCGGACGGGAGGGAAGGCTCGGCAGGCGCAACAAGACAGTCTCGGATCAGCGGCGTCATT
CACTTCGCCGCCTCCAAGTCGGTCTCTGAGTCCATCTCACGGCCAATCCAGTACTACCGAAACAACGTGTGCGGA
CTGGTAGACTTGGTCGAGCTTCTCGGCCAGTACAACATCCGGAACCTGGTCTTCTCGTCCTCGGCCACCGTGTAC
GGCTCCAAGGCGGACAAGGGCCGACCGCTGCGGGAAGAGGACCTCGTGCACGAGACGGAGACGTACGTCGACGGC
GACGGCAAGGCGGCCGTGGCCGAGCCCGCAGTGGCCGGGCTGCAGAGCCCGTACGCGCGGACCAAATACTTCTGC
GAGGCCATCCTGGCCGACATTGCGCGGTCAGACCCGGCATGGCGCATCGTCTGTCTGCGCTACTTCAATCCGGTC
GGCTGCGACTCGTCGGGCCAGCTGGGCGAGGACCCCAAGGGGACCCCGACCAACCTGTTCCCCGTCATGACGCAG
GTGCTGACGGGCGCCATCCAGGAGCTCAGCATCTTCGGCAGCGACTGGGGCACGCGGGATGGAACGGCGGTGCGC
GACTTCGTGCACGTGTCCGACGTGGCCCGCGGGCACATTGCAGCCCTGGCGTCCGAGGCCGAGGCGCCCTTCCGA
ACCTACAACCTGGGCTCGGGCACGGGGACGACGGTGGTGGAGGCGGTGCAGAGCCTCGAGGCGGCGGCTCGCCGG
CCCATCCCCGTGAGCCGCGTTGGTCGTCGGGTGGGCGACGTTGGCTTCTGCGTTGCGTCCAACGAACGTGCGGCG
CAAGAGCTCGGCTGGGCAGCCCAGGAGAGCATACCCAAGTGCGCCGAGGACCTGTGGAGGTTTGTGTCCAAGGAA
GTGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail