Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|789
Gene name
LocationContig_1163:6060..7335
Strand+
Gene length (bp)1275
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 3.1E-10 44 87
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 3.3E-07 45 86
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 8.3E-07 45 86

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5703 0.8589 0.0388 0.0107 0.155 0.0102 0.0752 0.0279 0.0259 0.0846

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup978
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|861
Ophiocordyceps australis map64 (Brazil) OphauB2|7608
Ophiocordyceps camponoti-floridani Ophcf2|00535
Ophiocordyceps camponoti-floridani Ophcf2|00536
Ophiocordyceps camponoti-rufipedis Ophun1|3389
Ophiocordyceps kimflemingae Ophio5|7640
Ophiocordyceps subramaniannii Hirsu2|789 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|789
MRPHDQGLPSTPERDSPQPDRTRLLDGENRCELLVVADKSSEESCVICLDVVTERCLLFPCGHHTFHFRCIDRWL
SESSARMCPVCKAVICRVVHGSAERRQTVEYDIPLPSPPRPNFPASSPHESRVQQSLNLAVQSGHARRDCPPAQP
PPARTEGHVPPDLAFRRQIYRRLLYSMHIGSNPVSRYRELSRDTFLHDRDLQSRAQLFLRRELQVFTWLSSPYSD
DLVRVDGESLRSFQRRLQRAPSAEGLLAHILGLLRHFEIRGSDGSLEDDLATHIGRENTRLLLHELQSFLRSPYQ
SLEDWDGAVQYADAPPGGIWRADGDDGIQDENASENASFRRRSRSCEARGNQDHGHRPTGSRFRPRYRRRDMPAR
PESARPGHDQSSVSFHESRGRPSHRLHHNGVPRVGTIFRHDRASDVSPG*
Coding >Hirsu2|789
ATGCGGCCGCATGATCAAGGTCTCCCCTCGACACCAGAAAGGGACTCTCCGCAACCTGATCGCACTCGGCTTTTG
GATGGCGAGAATCGCTGTGAGCTCCTGGTGGTCGCTGACAAGTCGTCCGAGGAGAGCTGCGTCATCTGCCTCGAC
GTCGTCACCGAGCGTTGTCTGTTGTTTCCATGCGGCCACCACACCTTTCACTTCCGATGCATTGATCGCTGGCTG
AGCGAGAGCTCGGCTCGCATGTGCCCAGTCTGCAAGGCCGTCATTTGTCGAGTGGTTCACGGTTCAGCCGAGCGC
CGGCAGACGGTCGAGTACGACATCCCTCTACCGTCTCCGCCGAGGCCGAATTTCCCGGCGTCCAGTCCCCACGAA
AGCCGGGTTCAACAATCGCTAAATCTCGCTGTGCAGTCTGGACATGCTCGGCGTGACTGCCCTCCAGCCCAGCCA
CCCCCAGCTCGAACAGAGGGACATGTGCCGCCTGACCTTGCCTTCCGGCGCCAAATCTACCGTCGGCTGCTGTAC
TCGATGCACATCGGGTCGAACCCCGTATCTCGCTATCGTGAGCTGAGTCGAGACACGTTCCTTCACGACCGAGAT
CTGCAAAGTCGCGCCCAACTCTTTCTGCGGCGAGAGCTTCAAGTCTTCACCTGGCTCTCCTCGCCATACTCCGAC
GACCTCGTCCGGGTCGATGGAGAGAGCCTTCGCTCATTTCAACGTCGGCTTCAGCGGGCGCCTTCGGCCGAGGGG
CTTCTTGCCCACATCTTGGGGCTGCTGCGTCATTTTGAGATTCGCGGCAGCGATGGGAGTCTCGAGGACGATTTG
GCAACCCATATTGGTCGCGAAAATACCAGGCTTCTACTGCACGAGCTACAATCTTTTCTCCGCAGCCCTTATCAA
AGCCTCGAGGACTGGGACGGTGCAGTCCAGTACGCCGACGCTCCGCCGGGGGGGATATGGCGAGCTGATGGAGAC
GACGGTATCCAAGATGAGAATGCCTCTGAGAATGCCTCTTTCCGACGTCGCAGCCGTAGCTGCGAGGCCCGAGGC
AACCAAGACCACGGGCATCGTCCGACCGGCAGCCGCTTCAGACCGCGCTATCGGCGGAGGGACATGCCTGCTCGC
CCGGAGTCGGCAAGGCCTGGACATGACCAGTCGAGTGTGTCCTTTCATGAGTCTCGTGGCCGCCCATCCCACCGT
CTTCACCACAACGGAGTCCCACGGGTGGGCACCATATTTCGCCATGATAGAGCTAGCGATGTATCGCCTGGATGA
Transcript >Hirsu2|789
ATGCGGCCGCATGATCAAGGTCTCCCCTCGACACCAGAAAGGGACTCTCCGCAACCTGATCGCACTCGGCTTTTG
GATGGCGAGAATCGCTGTGAGCTCCTGGTGGTCGCTGACAAGTCGTCCGAGGAGAGCTGCGTCATCTGCCTCGAC
GTCGTCACCGAGCGTTGTCTGTTGTTTCCATGCGGCCACCACACCTTTCACTTCCGATGCATTGATCGCTGGCTG
AGCGAGAGCTCGGCTCGCATGTGCCCAGTCTGCAAGGCCGTCATTTGTCGAGTGGTTCACGGTTCAGCCGAGCGC
CGGCAGACGGTCGAGTACGACATCCCTCTACCGTCTCCGCCGAGGCCGAATTTCCCGGCGTCCAGTCCCCACGAA
AGCCGGGTTCAACAATCGCTAAATCTCGCTGTGCAGTCTGGACATGCTCGGCGTGACTGCCCTCCAGCCCAGCCA
CCCCCAGCTCGAACAGAGGGACATGTGCCGCCTGACCTTGCCTTCCGGCGCCAAATCTACCGTCGGCTGCTGTAC
TCGATGCACATCGGGTCGAACCCCGTATCTCGCTATCGTGAGCTGAGTCGAGACACGTTCCTTCACGACCGAGAT
CTGCAAAGTCGCGCCCAACTCTTTCTGCGGCGAGAGCTTCAAGTCTTCACCTGGCTCTCCTCGCCATACTCCGAC
GACCTCGTCCGGGTCGATGGAGAGAGCCTTCGCTCATTTCAACGTCGGCTTCAGCGGGCGCCTTCGGCCGAGGGG
CTTCTTGCCCACATCTTGGGGCTGCTGCGTCATTTTGAGATTCGCGGCAGCGATGGGAGTCTCGAGGACGATTTG
GCAACCCATATTGGTCGCGAAAATACCAGGCTTCTACTGCACGAGCTACAATCTTTTCTCCGCAGCCCTTATCAA
AGCCTCGAGGACTGGGACGGTGCAGTCCAGTACGCCGACGCTCCGCCGGGGGGGATATGGCGAGCTGATGGAGAC
GACGGTATCCAAGATGAGAATGCCTCTGAGAATGCCTCTTTCCGACGTCGCAGCCGTAGCTGCGAGGCCCGAGGC
AACCAAGACCACGGGCATCGTCCGACCGGCAGCCGCTTCAGACCGCGCTATCGGCGGAGGGACATGCCTGCTCGC
CCGGAGTCGGCAAGGCCTGGACATGACCAGTCGAGTGTGTCCTTTCATGAGTCTCGTGGCCGCCCATCCCACCGT
CTTCACCACAACGGAGTCCCACGGGTGGGCACCATATTTCGCCATGATAGAGCTAGCGATGTATCGCCTGGATGA
Gene >Hirsu2|789
ATGCGGCCGCATGATCAAGGTCTCCCCTCGACACCAGAAAGGGACTCTCCGCAACCTGATCGCACTCGGCTTTTG
GATGGCGAGAATCGCTGTGAGCTCCTGGTGGTCGCTGACAAGTCGTCCGAGGAGAGCTGCGTCATCTGCCTCGAC
GTCGTCACCGAGCGTTGTCTGTTGTTTCCATGCGGCCACCACACCTTTCACTTCCGATGCATTGATCGCTGGCTG
AGCGAGAGCTCGGCTCGCATGTGCCCAGTCTGCAAGGCCGTCATTTGTCGAGTGGTTCACGGTTCAGCCGAGCGC
CGGCAGACGGTCGAGTACGACATCCCTCTACCGTCTCCGCCGAGGCCGAATTTCCCGGCGTCCAGTCCCCACGAA
AGCCGGGTTCAACAATCGCTAAATCTCGCTGTGCAGTCTGGACATGCTCGGCGTGACTGCCCTCCAGCCCAGCCA
CCCCCAGCTCGAACAGAGGGACATGTGCCGCCTGACCTTGCCTTCCGGCGCCAAATCTACCGTCGGCTGCTGTAC
TCGATGCACATCGGGTCGAACCCCGTATCTCGCTATCGTGAGCTGAGTCGAGACACGTTCCTTCACGACCGAGAT
CTGCAAAGTCGCGCCCAACTCTTTCTGCGGCGAGAGCTTCAAGTCTTCACCTGGCTCTCCTCGCCATACTCCGAC
GACCTCGTCCGGGTCGATGGAGAGAGCCTTCGCTCATTTCAACGTCGGCTTCAGCGGGCGCCTTCGGCCGAGGGG
CTTCTTGCCCACATCTTGGGGCTGCTGCGTCATTTTGAGATTCGCGGCAGCGATGGGAGTCTCGAGGACGATTTG
GCAACCCATATTGGTCGCGAAAATACCAGGCTTCTACTGCACGAGCTACAATCTTTTCTCCGCAGCCCTTATCAA
AGCCTCGAGGACTGGGACGGTGCAGTCCAGTACGCCGACGCTCCGCCGGGGGGGATATGGCGAGCTGATGGAGAC
GACGGTATCCAAGATGAGAATGCCTCTGAGAATGCCTCTTTCCGACGTCGCAGCCGTAGCTGCGAGGCCCGAGGC
AACCAAGACCACGGGCATCGTCCGACCGGCAGCCGCTTCAGACCGCGCTATCGGCGGAGGGACATGCCTGCTCGC
CCGGAGTCGGCAAGGCCTGGACATGACCAGTCGAGTGTGTCCTTTCATGAGTCTCGTGGCCGCCCATCCCACCGT
CTTCACCACAACGGAGTCCCACGGGTGGGCACCATATTTCGCCATGATAGAGCTAGCGATGTATCGCCTGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail