Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7889
Gene name
LocationContig_485:6668..9150
Strand-
Gene length (bp)2482
Transcript length (bp)2397
Coding sequence length (bp)2397
Protein length (aa) 799

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06432 GPI2 Phosphatidylinositol N-acetylglucosaminyltransferase 9.2E-86 513 783

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59802|GPI2_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase GPI2 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi2 PE=3 SV=1 604 787 8.0E-35
sp|Q54M40|PIGC_DICDI Putative phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Dictyostelium discoideum GN=pigC PE=3 SV=1 609 788 4.0E-29
sp|Q5PQQ4|PIGC_RAT Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Rattus norvegicus GN=Pigc PE=2 SV=1 605 786 5.0E-25
sp|Q92535|PIGC_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Homo sapiens GN=PIGC PE=2 SV=1 605 785 1.0E-24
sp|Q3ZBX1|PIGC_BOVIN Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Bos taurus GN=PIGC PE=2 SV=1 605 785 4.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59802|GPI2_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase GPI2 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi2 PE=3 SV=1 604 787 8.0E-35
sp|Q54M40|PIGC_DICDI Putative phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Dictyostelium discoideum GN=pigC PE=3 SV=1 609 788 4.0E-29
sp|Q5PQQ4|PIGC_RAT Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Rattus norvegicus GN=Pigc PE=2 SV=1 605 786 5.0E-25
sp|Q92535|PIGC_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Homo sapiens GN=PIGC PE=2 SV=1 605 785 1.0E-24
sp|Q3ZBX1|PIGC_BOVIN Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Bos taurus GN=PIGC PE=2 SV=1 605 785 4.0E-24
sp|Q9CXR4|PIGC_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Mus musculus GN=Pigc PE=2 SV=1 605 785 6.0E-24
sp|Q058N0|IQM5_ARATH IQ domain-containing protein IQM5 OS=Arabidopsis thaliana GN=IQM5 PE=2 SV=1 50 322 4.0E-21
sp|O82645|IQM1_ARATH IQ domain-containing protein IQM1 OS=Arabidopsis thaliana GN=IQM1 PE=1 SV=1 198 322 6.0E-20
sp|Q9M2G8|IQM6_ARATH IQ domain-containing protein IQM6 OS=Arabidopsis thaliana GN=IQM6 PE=2 SV=1 221 322 1.0E-18
sp|Q9LFA4|IQM3_ARATH IQ domain-containing protein IQM3 OS=Arabidopsis thaliana GN=IQM3 PE=2 SV=1 81 320 6.0E-18
sp|Q9LHN9|IQM2_ARATH IQ domain-containing protein IQM2 OS=Arabidopsis thaliana GN=IQM2 PE=2 SV=1 223 322 7.0E-18
sp|O64851|IQM4_ARATH IQ domain-containing protein IQM4 OS=Arabidopsis thaliana GN=IQM4 PE=2 SV=1 198 322 2.0E-17
sp|Q058N0|IQM5_ARATH IQ domain-containing protein IQM5 OS=Arabidopsis thaliana GN=IQM5 PE=2 SV=1 424 516 7.0E-17
sp|Q9M2G8|IQM6_ARATH IQ domain-containing protein IQM6 OS=Arabidopsis thaliana GN=IQM6 PE=2 SV=1 435 513 8.0E-16
sp|O82645|IQM1_ARATH IQ domain-containing protein IQM1 OS=Arabidopsis thaliana GN=IQM1 PE=1 SV=1 436 520 2.0E-15
sp|Q9LHN9|IQM2_ARATH IQ domain-containing protein IQM2 OS=Arabidopsis thaliana GN=IQM2 PE=2 SV=1 435 516 2.0E-15
sp|P46961|GPI2_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI2 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI2 PE=1 SV=2 605 789 6.0E-14
sp|O64851|IQM4_ARATH IQ domain-containing protein IQM4 OS=Arabidopsis thaliana GN=IQM4 PE=2 SV=1 436 520 1.0E-13
sp|Q9LFA4|IQM3_ARATH IQ domain-containing protein IQM3 OS=Arabidopsis thaliana GN=IQM3 PE=2 SV=1 435 518 5.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0017176 phosphatidylinositol N-acetylglucosaminyltransferase activity Yes
GO:0006506 GPI anchor biosynthetic process Yes
GO:0006644 phospholipid metabolic process No
GO:0006464 cellular protein modification process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0016758 transferase activity, transferring hexosyl groups No
GO:1903509 liposaccharide metabolic process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0046467 membrane lipid biosynthetic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0009058 biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0044425 membrane part No
GO:0006664 glycolipid metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:0031224 intrinsic component of membrane No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0008375 acetylglucosaminyltransferase activity No
GO:0006497 protein lipidation No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0044267 cellular protein metabolic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0008610 lipid biosynthetic process No
GO:0008654 phospholipid biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0006505 GPI anchor metabolic process No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0046486 glycerolipid metabolic process No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 633 655 22
2 711 733 22
3 748 770 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7889
MSLDSLGVAHAAPPKSKQYMDSLVPPDRERFERIAHVQAEKEVEAKRRARDKRKSLSISSMPSPSAAHFAGRRSD
EQRADAALMIQKTFRGYRARREMDGFGIDATTRWVTAIREAQFRQLTKPRARPSADEPAAAVAAAVPTLDDPIDR
RPSSARRNWQKASLVARRAGHDDDDDDSFSDSDSGSDPDRLAASDSSSAASPEQRAEAKRRRERANAQRRQAAQM
MGLQYFLEMVDVKHRYGSNLRMYHEEWKRSDTTDNFFYWLDYGDGRRIELDSCPRDRLDREQVRYLSREERQYYL
ATVDPDGRLCWAKNGERIDTTERYRDSVLGIVPADDPTPAYRPAPPPAPPETTADRSEGGGPAPPSRKASSSASS
SSGSGSGSSSAAESRREADRAAKYADPEYEGAHGVKKITHLSASTVFNKLLRKSVRKNTWIFVADTSFRLYVGIK
DSGAFQHSSFLQGSRISAAGLIKVKDGRLSSLSPLSGHYRPPASNFRAFVHGLRETGVDTSHVSISKSYTVLVGL
ETYSKTRRKGRDLVDRLVRRRDKMMAPDDFRRREEEQRDKSESAEKERRFLARQRRLEEEAAPPSAGDRENRVHQ
RLETIKSALLIYSTLLGLSPILKSLTRSTSSDSIWAMSFWLLAINIFFFDYSGAVGAKIPASLSTNAALMASTVL
ASRLPSTKQVFSLTLFSIEVFGLFPVFRRHVRHRSWRYHVVQTVLLVLGAGLGVGMVLGDAQAGGWPWKSGMVGM
AVGVLMAGLAAGGCSWWLIGLQKYKNEIRGPWDPARPIIMSRTRWDDR*
Coding >Hirsu2|7889
ATGTCGCTCGACAGCCTCGGCGTCGCCCACGCCGCGCCGCCCAAGAGCAAGCAGTACATGGACTCGCTCGTGCCT
CCCGATCGCGAGCGCTTCGAGCGCATCGCCCACGTCCAGGCCGAGAAGGAGGTCGAGGCCAAGCGCCGGGCGCGC
GACAAGCGCAAGTCGCTCTCCATCTCCTCCATGCCCTCGCCCTCGGCCGCCCACTTCGCCGGCCGCCGCAGCGAC
GAGCAGCGCGCCGACGCCGCCCTCATGATCCAGAAGACGTTCCGCGGCTACCGCGCCCGCCGCGAGATGGACGGC
TTCGGCATCGACGCCACCACCCGCTGGGTCACGGCCATCCGCGAGGCCCAGTTCCGCCAGTTGACCAAGCCGCGC
GCCCGGCCGTCGGCCGACGAGCCGGCCGCCGCCGTCGCCGCCGCCGTCCCGACCCTCGACGACCCCATCGACCGA
CGGCCGTCGAGCGCGCGTCGCAACTGGCAAAAGGCCAGCCTCGTCGCCCGCCGCGCCGGCCACGACGACGACGAC
GACGACAGCTTCTCCGACTCCGACTCCGGCTCCGACCCCGACCGTCTCGCCGCCTCCGACTCGTCCTCGGCCGCG
TCGCCCGAGCAGCGGGCCGAGGCCAAGCGGCGGCGCGAGCGGGCCAACGCCCAGCGCCGGCAGGCCGCCCAGATG
ATGGGCCTGCAGTACTTCCTCGAGATGGTCGACGTCAAGCACCGGTACGGCAGCAACCTGCGCATGTACCACGAG
GAGTGGAAGCGCTCCGACACCACCGACAACTTCTTCTACTGGCTCGACTACGGCGACGGCCGGCGCATCGAGCTC
GACTCGTGCCCGCGCGACCGCCTCGACCGCGAGCAGGTCCGCTACCTGTCGCGCGAGGAGCGCCAGTACTACCTC
GCCACCGTCGACCCGGACGGCCGCCTCTGCTGGGCCAAGAACGGCGAGCGCATCGACACGACGGAGCGGTACCGG
GACAGCGTCTTGGGCATCGTCCCCGCCGACGACCCCACGCCCGCCTACCGCCCGGCCCCGCCGCCGGCGCCCCCC
GAGACGACGGCGGACCGTTCGGAGGGCGGCGGGCCGGCACCACCGTCCCGCAAAGCGTCGTCGTCGGCGTCGTCG
TCGTCGGGGTCCGGGTCCGGGTCGTCGAGCGCGGCCGAGTCGCGCCGAGAGGCGGACCGGGCGGCCAAGTACGCG
GACCCGGAGTACGAGGGGGCGCACGGCGTCAAGAAGATCACGCACCTGTCGGCCTCGACCGTCTTCAACAAGCTG
CTGCGCAAGTCGGTGCGCAAGAACACGTGGATCTTCGTGGCCGACACGTCGTTCCGGCTCTACGTCGGCATCAAG
GACTCGGGCGCCTTCCAGCACTCGTCCTTCCTGCAGGGCAGCCGCATCTCGGCCGCCGGCCTGATCAAGGTCAAG
GACGGGCGCCTGTCGTCGCTGTCGCCGCTCAGCGGCCACTACCGGCCGCCGGCCTCCAACTTCCGGGCCTTCGTA
CACGGCCTGCGCGAGACGGGCGTCGACACGAGCCACGTCAGCATCTCCAAGTCGTATACGGTCCTCGTCGGCCTC
GAGACCTACTCCAAGACGCGCCGCAAGGGCCGCGACCTCGTCGACCGCCTCGTCCGCCGCCGCGACAAGATGATG
GCCCCCGACGACTTCCGCCGCCGCGAGGAGGAGCAGCGCGACAAGAGCGAGAGCGCCGAGAAGGAGCGCCGCTTC
CTCGCCCGGCAGCGCCGGTTGGAGGAGGAGGCGGCCCCGCCCAGCGCCGGCGACCGCGAGAACCGGGTGCACCAG
CGGCTGGAGACGATCAAGTCGGCGCTCCTGATCTACAGCACGCTGCTGGGCCTCAGCCCGATCCTCAAGTCGCTG
ACACGGTCGACGTCGAGCGACAGCATCTGGGCCATGTCGTTCTGGCTGCTGGCCATCAACATCTTCTTCTTCGAC
TACTCGGGCGCGGTGGGGGCCAAGATCCCGGCGTCGCTGTCGACGAACGCGGCGCTGATGGCGTCGACGGTGCTG
GCCAGCCGGCTGCCGTCGACGAAGCAGGTCTTCAGCCTGACGCTCTTCAGCATCGAGGTCTTCGGCCTGTTCCCC
GTCTTCCGGCGGCACGTGCGGCACCGCAGCTGGCGCTACCACGTGGTGCAGACGGTGCTGCTGGTGCTGGGGGCC
GGGCTGGGGGTCGGCATGGTGCTGGGGGACGCCCAGGCCGGCGGCTGGCCCTGGAAGAGCGGCATGGTGGGCATG
GCGGTCGGCGTGCTGATGGCGGGCCTGGCCGCGGGCGGCTGCAGCTGGTGGCTCATCGGGCTGCAGAAGTACAAG
AACGAGATCCGGGGGCCGTGGGACCCGGCGCGGCCCATCATCATGAGCAGGACCCGATGGGACGACCGGTAG
Transcript >Hirsu2|7889
ATGTCGCTCGACAGCCTCGGCGTCGCCCACGCCGCGCCGCCCAAGAGCAAGCAGTACATGGACTCGCTCGTGCCT
CCCGATCGCGAGCGCTTCGAGCGCATCGCCCACGTCCAGGCCGAGAAGGAGGTCGAGGCCAAGCGCCGGGCGCGC
GACAAGCGCAAGTCGCTCTCCATCTCCTCCATGCCCTCGCCCTCGGCCGCCCACTTCGCCGGCCGCCGCAGCGAC
GAGCAGCGCGCCGACGCCGCCCTCATGATCCAGAAGACGTTCCGCGGCTACCGCGCCCGCCGCGAGATGGACGGC
TTCGGCATCGACGCCACCACCCGCTGGGTCACGGCCATCCGCGAGGCCCAGTTCCGCCAGTTGACCAAGCCGCGC
GCCCGGCCGTCGGCCGACGAGCCGGCCGCCGCCGTCGCCGCCGCCGTCCCGACCCTCGACGACCCCATCGACCGA
CGGCCGTCGAGCGCGCGTCGCAACTGGCAAAAGGCCAGCCTCGTCGCCCGCCGCGCCGGCCACGACGACGACGAC
GACGACAGCTTCTCCGACTCCGACTCCGGCTCCGACCCCGACCGTCTCGCCGCCTCCGACTCGTCCTCGGCCGCG
TCGCCCGAGCAGCGGGCCGAGGCCAAGCGGCGGCGCGAGCGGGCCAACGCCCAGCGCCGGCAGGCCGCCCAGATG
ATGGGCCTGCAGTACTTCCTCGAGATGGTCGACGTCAAGCACCGGTACGGCAGCAACCTGCGCATGTACCACGAG
GAGTGGAAGCGCTCCGACACCACCGACAACTTCTTCTACTGGCTCGACTACGGCGACGGCCGGCGCATCGAGCTC
GACTCGTGCCCGCGCGACCGCCTCGACCGCGAGCAGGTCCGCTACCTGTCGCGCGAGGAGCGCCAGTACTACCTC
GCCACCGTCGACCCGGACGGCCGCCTCTGCTGGGCCAAGAACGGCGAGCGCATCGACACGACGGAGCGGTACCGG
GACAGCGTCTTGGGCATCGTCCCCGCCGACGACCCCACGCCCGCCTACCGCCCGGCCCCGCCGCCGGCGCCCCCC
GAGACGACGGCGGACCGTTCGGAGGGCGGCGGGCCGGCACCACCGTCCCGCAAAGCGTCGTCGTCGGCGTCGTCG
TCGTCGGGGTCCGGGTCCGGGTCGTCGAGCGCGGCCGAGTCGCGCCGAGAGGCGGACCGGGCGGCCAAGTACGCG
GACCCGGAGTACGAGGGGGCGCACGGCGTCAAGAAGATCACGCACCTGTCGGCCTCGACCGTCTTCAACAAGCTG
CTGCGCAAGTCGGTGCGCAAGAACACGTGGATCTTCGTGGCCGACACGTCGTTCCGGCTCTACGTCGGCATCAAG
GACTCGGGCGCCTTCCAGCACTCGTCCTTCCTGCAGGGCAGCCGCATCTCGGCCGCCGGCCTGATCAAGGTCAAG
GACGGGCGCCTGTCGTCGCTGTCGCCGCTCAGCGGCCACTACCGGCCGCCGGCCTCCAACTTCCGGGCCTTCGTA
CACGGCCTGCGCGAGACGGGCGTCGACACGAGCCACGTCAGCATCTCCAAGTCGTATACGGTCCTCGTCGGCCTC
GAGACCTACTCCAAGACGCGCCGCAAGGGCCGCGACCTCGTCGACCGCCTCGTCCGCCGCCGCGACAAGATGATG
GCCCCCGACGACTTCCGCCGCCGCGAGGAGGAGCAGCGCGACAAGAGCGAGAGCGCCGAGAAGGAGCGCCGCTTC
CTCGCCCGGCAGCGCCGGTTGGAGGAGGAGGCGGCCCCGCCCAGCGCCGGCGACCGCGAGAACCGGGTGCACCAG
CGGCTGGAGACGATCAAGTCGGCGCTCCTGATCTACAGCACGCTGCTGGGCCTCAGCCCGATCCTCAAGTCGCTG
ACACGGTCGACGTCGAGCGACAGCATCTGGGCCATGTCGTTCTGGCTGCTGGCCATCAACATCTTCTTCTTCGAC
TACTCGGGCGCGGTGGGGGCCAAGATCCCGGCGTCGCTGTCGACGAACGCGGCGCTGATGGCGTCGACGGTGCTG
GCCAGCCGGCTGCCGTCGACGAAGCAGGTCTTCAGCCTGACGCTCTTCAGCATCGAGGTCTTCGGCCTGTTCCCC
GTCTTCCGGCGGCACGTGCGGCACCGCAGCTGGCGCTACCACGTGGTGCAGACGGTGCTGCTGGTGCTGGGGGCC
GGGCTGGGGGTCGGCATGGTGCTGGGGGACGCCCAGGCCGGCGGCTGGCCCTGGAAGAGCGGCATGGTGGGCATG
GCGGTCGGCGTGCTGATGGCGGGCCTGGCCGCGGGCGGCTGCAGCTGGTGGCTCATCGGGCTGCAGAAGTACAAG
AACGAGATCCGGGGGCCGTGGGACCCGGCGCGGCCCATCATCATGAGCAGGACCCGATGGGACGACCGGTAG
Gene >Hirsu2|7889
ATGTCGCTCGACAGCCTCGGCGTCGCCCACGCCGCGCCGCCCAAGAGCAAGCAGTACATGGACTCGCTCGTGCCT
CCCGATCGCGAGCGCTTCGAGCGCATCGCCCACGTCCAGGCCGAGAAGGAGGTCGAGGCCAAGCGCCGGGCGCGC
GACAAGCGCAAGTCGCTCTCCATCTCCTCCATGCCCTCGCCCTCGGCCGCCCACTTCGCCGGCCGCCGCAGCGAC
GAGCAGCGCGCCGACGCCGCCCTCATGATCCAGAAGACGTTCCGCGGCTACCGCGCCCGCCGCGAGATGGACGGC
TTCGGCATCGACGCCACCACCCGCTGGGTCACGGCCATCCGCGAGGCCCAGTTCCGCCAGTTGACCAAGCCGCGC
GCCCGGCCGTCGGCCGACGAGCCGGCCGCCGCCGTCGCCGCCGCCGTCCCGACCCTCGACGACCCCATCGACCGA
CGGCCGTCGAGCGCGCGTCGCAACTGGCAAAAGGCCAGCCTCGTCGCCCGCCGCGCCGGCCACGACGACGACGAC
GACGACAGCTTCTCCGACTCCGACTCCGGCTCCGACCCCGACCGTCTCGCCGCCTCCGACTCGTCCTCGGCCGCG
TCGCCCGAGCAGCGGGCCGAGGCCAAGCGGCGGCGCGAGCGGGCCAACGCCCAGCGCCGGCAGGCCGCCCAGATG
ATGGGCCTGCAGTACTTCCTCGAGATGGTCGACGTCAAGCACCGGTACGGCAGCAACCTGCGCATGTACCACGAG
GAGTGGAAGCGCTCCGACACCACCGACAACTTCTTCTACTGGCTCGACTACGGCGACGGCCGGCGCATCGAGCTC
GACTCGTGCCCGCGCGACCGCCTCGACCGCGAGCAGGTCCGCTACCTGTCGCGCGAGGAGCGCCAGTACTACCTC
GCCACCGTCGACCCGGACGGCCGCCTCTGCTGGGCCAAGAACGGCGAGCGCATCGACACGACGGAGCGGTACCGG
GACAGCGTCTTGGGCATCGTCCCCGCCGACGACCCCACGCCCGCCTACCGCCCGGCCCCGCCGCCGGCGCCCCCC
GAGACGACGGCGGACCGTTCGGAGGGCGGCGGGCCGGCACCACCGTCCCGCAAAGCGTCGTCGTCGGCGTCGTCG
TCGTCGGGGTCCGGGTCCGGGTCGTCGAGCGCGGCCGAGTCGCGCCGAGAGGCGGACCGGGCGGCCAAGTACGCG
GACCCGGAGTACGAGGGGGCGCACGGCGTCAAGAAGATCACGCACCTGTCGGCCTCGACCGTCTTCAACAAGCTG
CTGCGCAAGTCGGTGCGCAAGAACACGTGGATCTTCGTGGCCGACACGTCGTTCCGGCTCTACGTCGGCATCAAG
GACTCGGGCGCCTTCCAGCACTCGTCCTTCCTGCAGGGCAGCCGCATCTCGGCCGCCGGCCTGATCAAGGTCAAG
GACGGGCGCCTGTCGTCGCTGTCGCCGCTCAGCGGCCACTACCGGCCGCCGGCCTCCAACTTCCGGGCCTTCGTA
CACGGCCTGCGCGAGACGGGCGTCGACACGAGCCACGTCAGCATCTCCAAGTCGTATACGGTCCTCGTCGGCCTC
GAGACCTACTCCAAGACGCGCCGCAAGGGCCGCGACCTCGTCGACCGCCTCGTCCGCCGCCGCGACAAGATGATG
GCCCCCGACGACTTCCGCCGCCGCGAGGAGGAGCAGCGCGACAAGAGCGAGAGCGCCGAGAAGGAGCGCCGCTTC
CTCGCCCGGCAGCGCCGGTTGGAGGAGGAGGCGGCCCCGCCCAGCGCCGGCGACCGCGTCCTGGAGAAGCTCCGC
GCGCTTCCCATCACGGCCGGCCCCCGGGGCGACGGCGGCGGGCGACGGGCCGGCGGCGGCGGTGCAGGAGAACCG
GGTGCACCAGCGGCTGGAGACGATCAAGTCGGCGCTCCTGATCTACAGCACGCTGCTGGGCCTCAGCCCGATCCT
CAAGTCGCTGACACGGTCGACGTCGAGCGACAGCATCTGGGCCATGTCGTTCTGGCTGCTGGCCATCAACATCTT
CTTCTTCGACTACTCGGGCGCGGTGGGGGCCAAGATCCCGGCGTCGCTGTCGACGAACGCGGCGCTGATGGCGTC
GACGGTGCTGGCCAGCCGGCTGCCGTCGACGAAGCAGGTCTTCAGCCTGACGCTCTTCAGCATCGAGGTCTTCGG
CCTGTTCCCCGTCTTCCGGCGGCACGTGCGGCACCGCAGCTGGCGCTACCACGTGGTGCAGACGGTGCTGCTGGT
GCTGGGGGCCGGGCTGGGGGTCGGCATGGTGCTGGGGGACGCCCAGGCCGGCGGCTGGCCCTGGAAGAGCGGCAT
GGTGGGCATGGCGGTCGGCGTGCTGATGGCGGGCCTGGCCGCGGGCGGCTGCAGCTGGTGGCTCATCGGGCTGCA
GAAGTACAAGAACGAGATCCGGGGGCCGTGGGACCCGGCGCGGCCCATCATCATGAGCAGGACCCGATGGGACGA
CCGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail