Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7880
Gene name
LocationContig_484:8639..9698
Strand+
Gene length (bp)1059
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07264 EI24 Etoposide-induced protein 2.4 (EI24) 4.5E-09 49 263

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 103 125 22
3 188 210 22
4 243 265 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7880
MDGTVPVSIERRSSRGSSYSGSGGGGGGGGGGGRRGVSYVKRAVVAASYPFRGIWFCLRHREFWPLFVGRLLPLS
LISVVVYLLLFTFAFLPQYGLLALFHGWGAWINAVVLTLGEGLVIIQGLFEGFFVDECRVDLFDATLIKLGLRDL
VSPHRVLHDHASDAVKMLGKPTSPAVYQPWSIIQIVELVVFLPLNFVPVVGTPAFIIITGTRLGKLSQYRWFQLR
GLSKHERNDEIRDRTWDYVWFGTVAMILELIPVLSFFFLLTTTAGSAIWAARFEADKRRRSSYVDAHFVTEQQPS
PPLSPQPSPQPPPYSDEAV*
Coding >Hirsu2|7880
ATGGACGGTACCGTTCCGGTCAGCATCGAGAGGAGGTCGAGCCGCGGCAGCAGCTACAGCGGTAGCGGCGGCGGC
GGCGGCGGCGGCGGCGGCGGCGGGCGGCGCGGCGTCTCGTACGTCAAGCGCGCCGTCGTCGCGGCCTCGTATCCC
TTCCGCGGCATCTGGTTCTGCTTGCGCCATCGCGAGTTCTGGCCGCTCTTCGTCGGCCGCCTGCTCCCGCTGTCC
CTCATCTCCGTCGTCGTCTACCTCCTCCTCTTCACCTTCGCCTTCCTCCCGCAGTACGGCCTCCTCGCCCTCTTC
CACGGTTGGGGTGCTTGGATCAACGCCGTCGTCTTGACCCTGGGCGAGGGCCTGGTCATCATCCAGGGTCTTTTC
GAGGGCTTCTTTGTCGACGAGTGTCGCGTCGATCTCTTTGATGCTACCCTGATCAAGCTGGGCCTCCGGGATCTC
GTCTCTCCGCACCGCGTCCTCCACGACCACGCGTCCGACGCCGTCAAGATGCTGGGCAAGCCCACCAGCCCGGCC
GTCTACCAGCCGTGGAGCATCATCCAGATCGTCGAGCTCGTCGTCTTCCTGCCGCTCAACTTTGTGCCCGTCGTC
GGCACGCCCGCCTTCATCATCATCACCGGCACCCGGCTCGGCAAGCTGTCGCAGTACCGCTGGTTCCAGCTGCGC
GGCCTGTCCAAGCACGAGCGCAACGACGAGATACGCGACCGGACCTGGGACTACGTCTGGTTCGGGACCGTGGCC
ATGATCCTCGAGCTGATCCCCGTCCTGTCCTTCTTCTTCCTCCTCACCACCACCGCCGGCTCCGCCATCTGGGCC
GCGAGGTTCGAGGCCGACAAGAGGCGCCGCTCGAGCTACGTCGACGCCCATTTCGTCACCGAGCAGCAGCCGTCG
CCGCCGTTGTCGCCGCAGCCGTCGCCGCAGCCGCCGCCCTACTCGGACGAGGCCGTCTGA
Transcript >Hirsu2|7880
ATGGACGGTACCGTTCCGGTCAGCATCGAGAGGAGGTCGAGCCGCGGCAGCAGCTACAGCGGTAGCGGCGGCGGC
GGCGGCGGCGGCGGCGGCGGCGGGCGGCGCGGCGTCTCGTACGTCAAGCGCGCCGTCGTCGCGGCCTCGTATCCC
TTCCGCGGCATCTGGTTCTGCTTGCGCCATCGCGAGTTCTGGCCGCTCTTCGTCGGCCGCCTGCTCCCGCTGTCC
CTCATCTCCGTCGTCGTCTACCTCCTCCTCTTCACCTTCGCCTTCCTCCCGCAGTACGGCCTCCTCGCCCTCTTC
CACGGTTGGGGTGCTTGGATCAACGCCGTCGTCTTGACCCTGGGCGAGGGCCTGGTCATCATCCAGGGTCTTTTC
GAGGGCTTCTTTGTCGACGAGTGTCGCGTCGATCTCTTTGATGCTACCCTGATCAAGCTGGGCCTCCGGGATCTC
GTCTCTCCGCACCGCGTCCTCCACGACCACGCGTCCGACGCCGTCAAGATGCTGGGCAAGCCCACCAGCCCGGCC
GTCTACCAGCCGTGGAGCATCATCCAGATCGTCGAGCTCGTCGTCTTCCTGCCGCTCAACTTTGTGCCCGTCGTC
GGCACGCCCGCCTTCATCATCATCACCGGCACCCGGCTCGGCAAGCTGTCGCAGTACCGCTGGTTCCAGCTGCGC
GGCCTGTCCAAGCACGAGCGCAACGACGAGATACGCGACCGGACCTGGGACTACGTCTGGTTCGGGACCGTGGCC
ATGATCCTCGAGCTGATCCCCGTCCTGTCCTTCTTCTTCCTCCTCACCACCACCGCCGGCTCCGCCATCTGGGCC
GCGAGGTTCGAGGCCGACAAGAGGCGCCGCTCGAGCTACGTCGACGCCCATTTCGTCACCGAGCAGCAGCCGTCG
CCGCCGTTGTCGCCGCAGCCGTCGCCGCAGCCGCCGCCCTACTCGGACGAGGCCGTCTGA
Gene >Hirsu2|7880
ATGGACGGTACCGTTCCGGTCAGCATCGAGAGGAGGTCGAGCCGCGGCAGCAGCTACAGCGGTAGCGGCGGCGGC
GGCGGCGGCGGCGGCGGCGGCGGGCGGCGCGGCGTCTCGTACGTCAAGCGCGCCGTCGTCGCGGCCTCGTATCCC
TTCCGCGGCATCTGGTTCTGCTTGCGCCATCGCGAGTTCTGGCCGCTCTTCGTCGGCCGCCTGCTCCCGCTGTCC
CTCATCTCCGTCGTCGTCTACCTCCTCCTCTTCACCTTCGCCTTCCTCCCGCAGTACGGCCTCCTCGCCCTCTTC
CACGGTTGGGGTGCTTGGATCAACGCCGTCGTCTTGACCCTGGGCGAGGGCCTGGTCATCATCCAGGGTCTTTTC
GAGGGCTTCTTTGTCGACGAGTGTCGCGTCGATCTCTTTGATGTGCGTCTCCCGCCTTCGTCTCTGCCCGTCACG
GGAGACGGTTGAGTTGCCGACTGACCGATTCTCTCTCTCCCTCTCCCTCTCTCCCCCTTTCTACAGGCTACCCTG
ATCAAGCTGGGCCTCCGGGATCTCGTCTCTCCGCACCGCGTCCTCCACGACCACGCGTCCGACGCCGTCAAGATG
CTGGGCAAGCCCACCAGCCCGGCCGTCTACCAGCCGTGGAGCATCATCCAGATCGTCGAGCTCGTCGTCTTCCTG
CCGCTCAACTTTGTGCCCGTCGTCGGCACGCCCGCCTTCATCATCATCACCGGCACCCGGCTCGGCAAGCTGTCG
CAGTACCGCTGGTTCCAGCTGCGCGGCCTGTCCAAGCACGAGCGCAACGACGAGATACGCGACCGGACCTGGGAC
TACGTCTGGTTCGGGACCGTGGCCATGATCCTCGAGCTGATCCCCGTCCTGTCCTTCTTCTTCCTCCTCACCACC
ACCGCCGGCTCCGCCATCTGGGCCGCGAGGTTCGAGGCCGACAAGAGGCGCCGCTCGAGCTACGTCGACGCCCAT
TTCGTCACCGAGCAGCAGCCGTCGCCGCCGTTGTCGCCGCAGCCGTCGCCGCAGCCGCCGCCCTACTCGGACGAG
GCCGTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail