Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7877
Gene name
LocationContig_484:1879..3538
Strand+
Gene length (bp)1659
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.0E-13 76 181

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 42 150 1.0E-13
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 6 176 4.0E-10
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 13 181 4.0E-10
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 37 179 2.0E-08
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 37 175 8.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 42 150 1.0E-13
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 6 176 4.0E-10
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 13 181 4.0E-10
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 37 179 2.0E-08
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 37 175 8.0E-08
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 173 340 8.0E-07
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 173 340 8.0E-07
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 148 403 1.0E-06
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 55 179 2.0E-06
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 45 179 2.0E-06
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 6 179 3.0E-06
sp|P39637|YWFA_BACSU Uncharacterized MFS-type transporter YwfA OS=Bacillus subtilis (strain 168) GN=ywfA PE=3 SV=1 90 176 5.0E-06
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 45 170 6.0E-06
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 47 173 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0006810 transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole 0.1101 0.0915 0.1136 0.6161 0.0686 0.0084 0.2798 0.5834 0.1348 0.0147

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 41 63 22
2 88 108 20
3 118 140 22
4 147 169 22
5 215 237 22
6 249 271 22
7 302 324 22
8 377 396 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup8
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7347
Ophiocordyceps australis 1348a (Ghana) OphauG2|6185
Ophiocordyceps australis 1348a (Ghana) OphauG2|6184
Ophiocordyceps australis 1348a (Ghana) OphauG2|4319
Ophiocordyceps australis 1348a (Ghana) OphauG2|2577
Ophiocordyceps australis map64 (Brazil) OphauB2|5957
Ophiocordyceps australis map64 (Brazil) OphauB2|5874
Ophiocordyceps australis map64 (Brazil) OphauB2|4758
Ophiocordyceps camponoti-floridani Ophcf2|05963
Ophiocordyceps camponoti-floridani Ophcf2|03978
Ophiocordyceps camponoti-floridani Ophcf2|02403
Ophiocordyceps camponoti-floridani Ophcf2|01253
Ophiocordyceps camponoti-rufipedis Ophun1|2986
Ophiocordyceps camponoti-rufipedis Ophun1|2323
Ophiocordyceps camponoti-rufipedis Ophun1|1878
Ophiocordyceps camponoti-rufipedis Ophun1|508
Ophiocordyceps camponoti-rufipedis Ophun1|851
Ophiocordyceps kimflemingae Ophio5|8500
Ophiocordyceps kimflemingae Ophio5|4409
Ophiocordyceps kimflemingae Ophio5|148
Ophiocordyceps kimflemingae Ophio5|1355
Ophiocordyceps kimflemingae Ophio5|1106
Ophiocordyceps subramaniannii Hirsu2|8775
Ophiocordyceps subramaniannii Hirsu2|1361
Ophiocordyceps subramaniannii Hirsu2|2115
Ophiocordyceps subramaniannii Hirsu2|3848
Ophiocordyceps subramaniannii Hirsu2|9013
Ophiocordyceps subramaniannii Hirsu2|3880
Ophiocordyceps subramaniannii Hirsu2|4437
Ophiocordyceps subramaniannii Hirsu2|5818
Ophiocordyceps subramaniannii Hirsu2|6281
Ophiocordyceps subramaniannii Hirsu2|6753
Ophiocordyceps subramaniannii Hirsu2|7367
Ophiocordyceps subramaniannii Hirsu2|749
Ophiocordyceps subramaniannii Hirsu2|7877 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7952
Ophiocordyceps subramaniannii Hirsu2|3998
Ophiocordyceps subramaniannii Hirsu2|10375

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7877
MSPLPSSDDDAHAAKEAVPEAETRPSMARYLPLSHWRTVLTVLSLAIGTLLVAIDTTIISVAVPRIATDFAAFHH
VGYMYRFFDAKCIYLSSVVVFEVGSVLCAAAPVSPVFILGRALQGIGAAGLYQGALSVIALTVALDKRPMVIGIV
LSIFGLAVCFGPPVGGVLTDEYLFYLPFYFQSAQMVDARESGIRAIPLGLSQIVSVVVCSGLVTAFGHYVPFMIA
GQLVAIVGNALLTRIQVDTPTAVWATYLVVTGIGTGMGLQTPFTAVQLVLRSVRHLSLPGCPADARFSKEDVPVG
NAIVVFFQQLGAAVAVAAGQSIFSSGLQDELTKGNIPIPARAVQMAGPTGIRTLTTNPALIRLIQNAYCYAFRDT
MYFALAALVVAIPFALRMQWLNARAVAKAAAAEEHAS*
Coding >Hirsu2|7877
ATGTCGCCGCTGCCGTCGAGCGACGACGACGCGCACGCCGCCAAAGAGGCGGTCCCAGAAGCAGAGACCAGGCCA
AGCATGGCGAGATACCTCCCTCTGTCCCACTGGCGGACGGTGCTCACGGTGCTGTCGCTGGCCATCGGGACGCTG
CTGGTGGCCATCGACACGACCATCATCAGCGTGGCAGTGCCGCGCATCGCGACCGACTTCGCCGCCTTCCACCAC
GTCGGCTACATGTACCGCTTCTTCGACGCCAAATGCATCTATCTGTCGTCGGTCGTCGTGTTCGAAGTCGGCTCC
GTCCTGTGTGCCGCCGCCCCGGTCTCGCCCGTCTTCATCCTCGGACGGGCCTTGCAGGGCATCGGCGCCGCCGGC
CTGTATCAAGGCGCCCTCTCCGTCATCGCCCTTACCGTCGCCCTGGACAAGCGACCGATGGTCATCGGCATCGTC
CTGAGCATCTTCGGCCTGGCCGTGTGCTTCGGGCCTCCGGTCGGCGGCGTGCTGACGGACGAGTACCTCTTCTAC
CTGCCCTTCTACTTCCAGTCGGCGCAAATGGTCGACGCGCGTGAAAGCGGCATCCGCGCCATACCGCTTGGGCTA
TCGCAAATCGTCTCCGTCGTCGTCTGCAGCGGTCTGGTTACCGCCTTCGGTCACTATGTTCCCTTCATGATTGCC
GGCCAGCTGGTGGCCATCGTCGGCAACGCCCTTCTCACGCGCATCCAAGTCGATACGCCGACAGCCGTCTGGGCC
ACGTACCTGGTCGTCACCGGCATCGGGACCGGCATGGGTCTTCAGACGCCCTTTACGGCAGTCCAGCTCGTGTTG
AGGTCGGTTCGTCATCTCTCGCTCCCGGGCTGCCCTGCTGATGCCAGGTTCAGCAAGGAAGACGTCCCCGTCGGA
AACGCCATCGTCGTCTTCTTCCAGCAACTCGGGGCGGCCGTCGCCGTCGCCGCCGGCCAAAGCATCTTTTCGAGC
GGCCTGCAAGACGAACTGACCAAAGGCAACATCCCGATTCCCGCTCGGGCGGTCCAGATGGCCGGGCCGACGGGC
ATTCGCACCCTGACGACCAATCCGGCACTGATTCGATTGATCCAAAACGCATACTGCTACGCTTTTCGCGACACC
ATGTATTTTGCTCTGGCCGCTCTCGTTGTCGCCATTCCCTTTGCTCTTCGGATGCAGTGGCTCAACGCAAGGGCG
GTGGCCAAGGCTGCGGCCGCCGAGGAACATGCCAGCTAG
Transcript >Hirsu2|7877
ATGTCGCCGCTGCCGTCGAGCGACGACGACGCGCACGCCGCCAAAGAGGCGGTCCCAGAAGCAGAGACCAGGCCA
AGCATGGCGAGATACCTCCCTCTGTCCCACTGGCGGACGGTGCTCACGGTGCTGTCGCTGGCCATCGGGACGCTG
CTGGTGGCCATCGACACGACCATCATCAGCGTGGCAGTGCCGCGCATCGCGACCGACTTCGCCGCCTTCCACCAC
GTCGGCTACATGTACCGCTTCTTCGACGCCAAATGCATCTATCTGTCGTCGGTCGTCGTGTTCGAAGTCGGCTCC
GTCCTGTGTGCCGCCGCCCCGGTCTCGCCCGTCTTCATCCTCGGACGGGCCTTGCAGGGCATCGGCGCCGCCGGC
CTGTATCAAGGCGCCCTCTCCGTCATCGCCCTTACCGTCGCCCTGGACAAGCGACCGATGGTCATCGGCATCGTC
CTGAGCATCTTCGGCCTGGCCGTGTGCTTCGGGCCTCCGGTCGGCGGCGTGCTGACGGACGAGTACCTCTTCTAC
CTGCCCTTCTACTTCCAGTCGGCGCAAATGGTCGACGCGCGTGAAAGCGGCATCCGCGCCATACCGCTTGGGCTA
TCGCAAATCGTCTCCGTCGTCGTCTGCAGCGGTCTGGTTACCGCCTTCGGTCACTATGTTCCCTTCATGATTGCC
GGCCAGCTGGTGGCCATCGTCGGCAACGCCCTTCTCACGCGCATCCAAGTCGATACGCCGACAGCCGTCTGGGCC
ACGTACCTGGTCGTCACCGGCATCGGGACCGGCATGGGTCTTCAGACGCCCTTTACGGCAGTCCAGCTCGTGTTG
AGGTCGGTTCGTCATCTCTCGCTCCCGGGCTGCCCTGCTGATGCCAGGTTCAGCAAGGAAGACGTCCCCGTCGGA
AACGCCATCGTCGTCTTCTTCCAGCAACTCGGGGCGGCCGTCGCCGTCGCCGCCGGCCAAAGCATCTTTTCGAGC
GGCCTGCAAGACGAACTGACCAAAGGCAACATCCCGATTCCCGCTCGGGCGGTCCAGATGGCCGGGCCGACGGGC
ATTCGCACCCTGACGACCAATCCGGCACTGATTCGATTGATCCAAAACGCATACTGCTACGCTTTTCGCGACACC
ATGTATTTTGCTCTGGCCGCTCTCGTTGTCGCCATTCCCTTTGCTCTTCGGATGCAGTGGCTCAACGCAAGGGCG
GTGGCCAAGGCTGCGGCCGCCGAGGAACATGCCAGCTAG
Gene >Hirsu2|7877
ATGTCGCCGCTGCCGTCGAGCGACGACGACGCGCACGCCGCCAAAGAGGCGGTCCCAGAAGCAGAGACCAGGCCA
AGCATGGCGAGATACCTCCCTCTGTCCCACTGGCGGACGGTGCTCACGGTGCTGTCGCTGGCCATCGGGACGCTG
CTGGTGGCCATCGACACGACCATCATCAGCGTGGCAGTGCCGCGCATCGCGACCGACTTCGCCGCCTTCCACCAC
GTCGGCTAGTACGGCTCGGCCTACCTATTCACCGTCACGGCCTTCCAGCCGGCCGTGGGAAGCATGTACCGCTTC
TTCGACGCCAAATGCATCTATCTGTCGTCGGTCGTCGTGTTCGAAGGTGAGGCCGGAGCAGATGGCCGATGACGA
CGGCGGAGAGCCGGTCCCGCTGATGCTTTGCGCAACCCGCACAGTCGGCTCCGTCCTGTGTGCCGCCGCCCCGGT
CTCGCCCGTCTTCATCCTCGGACGGGCCTTGCAGGGCATCGGCGCCGCCGGCCTGTATCAAGGCGCCCTCTCCGT
CATCGCCCTTACCGTCGCCCTGGACAAGCGACCGATGGTCATCGGCATCGTCCTGAGCATCTTCGGCCTGGCCGT
GTGCTTCGGGCCTCCGGTCGGCGGCGTGCTGACGGACGAGGTGACGTGGAGGTGGTGCTTCTGGATGTGCGTCCC
CCCTTTGGGCCTTTGGCCGCCCCCTGACCCTTATCCTGACCTGCCGCTCCATCGTGGACACTTTTCTATCGATAT
AGTACCTCTTCTACCTGCCCTTCTACTTCCAGTCGGCGCAAATGGTCGACGCGCGTGAAAGCGGCATCCGCGCCA
TACCGCTTGGGCTATCGCAAATCGTCTCCGTCGTCGTCTGCAGCGGTCTGGTTACCGCCTTCGGTCACTATGTAG
GTCCATACCGTCTGTCGCGATCCCCCTCGGCCGGTCTAGTCGAGAGACTGAGCGAGAGGTCAGGTTCCCTTCATG
ATTGCCGGCCAGCTGGTGGCCATCGTCGGCAACGCCCTTCTCACGCGCATCCAAGTCGATACGCCGACAGCCGTC
TGGGCCACGTACCTGGTCGTCACCGGCATCGGGACCGGCATGGGTCTTCAGACGCCCTTTACGGCAGTCCAGCTC
GTGTTGAGGTCGGTTCGTCATCTCTCGCTCCCGGGCTGCCCTGCTGATGCCAGGTTCAGCAAGGAAGACGTCCCC
GTCGGAAACGGTACGTAACCTGCACCGTTCTTCCAAGTGTCGAACAAAGCCGACTCACGAGGAATGGCAGCCATC
GTCGTCTTCTTCCAGCAACTCGGGGCGTAGGTTGGATTCCGGAACGTCCCGCCGGCATGCCGTGGCTGACCAGCT
CGCAGGGCCGTCGCCGTCGCCGCCGGCCAAAGCATCTTTTCGAGCGGCCTGCAAGACGAACTGACCAAAGGCAAC
ATCCCGATTCCCGCTCGGGCGGTCCAGATGGCCGGGCCGACGGGCATTCGCACCCTGACGACCAATCCGGCACTG
ATTCGATTGATCCAAAACGCATACTGCTACGCTTTTCGCGACACCATGTATTTTGCTCTGGCCGCTCTCGTTGTC
GCCATTCCCTTTGCTCTTCGGATGCAGTGGCTCAACGCAAGGGCGGTGGCCAAGGCTGCGGCCGCCGAGGAACAT
GCCAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail