Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7877
Gene name
LocationContig_484:1879..3538
Strand+
Gene length (bp)1659
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.8E-13 76 181

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 42 150 1.0E-13
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 6 176 4.0E-10
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 13 181 4.0E-10
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 37 179 2.0E-08
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 37 175 8.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 42 150 1.0E-13
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 6 176 4.0E-10
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 13 181 4.0E-10
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 37 179 2.0E-08
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 37 175 8.0E-08
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 173 340 8.0E-07
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 173 340 8.0E-07
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 148 403 1.0E-06
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 55 179 2.0E-06
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 45 179 2.0E-06
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 6 179 3.0E-06
sp|P39637|YWFA_BACSU Uncharacterized MFS-type transporter YwfA OS=Bacillus subtilis (strain 168) GN=ywfA PE=3 SV=1 90 176 5.0E-06
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 45 170 6.0E-06
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 47 173 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 41 63 22
2 88 108 20
3 118 140 22
4 147 169 22
5 215 237 22
6 249 271 22
7 302 324 22
8 377 396 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7877
MSPLPSSDDDAHAAKEAVPEAETRPSMARYLPLSHWRTVLTVLSLAIGTLLVAIDTTIISVAVPRIATDFAAFHH
VGYMYRFFDAKCIYLSSVVVFEVGSVLCAAAPVSPVFILGRALQGIGAAGLYQGALSVIALTVALDKRPMVIGIV
LSIFGLAVCFGPPVGGVLTDEYLFYLPFYFQSAQMVDARESGIRAIPLGLSQIVSVVVCSGLVTAFGHYVPFMIA
GQLVAIVGNALLTRIQVDTPTAVWATYLVVTGIGTGMGLQTPFTAVQLVLRSVRHLSLPGCPADARFSKEDVPVG
NAIVVFFQQLGAAVAVAAGQSIFSSGLQDELTKGNIPIPARAVQMAGPTGIRTLTTNPALIRLIQNAYCYAFRDT
MYFALAALVVAIPFALRMQWLNARAVAKAAAAEEHAS*
Coding >Hirsu2|7877
ATGTCGCCGCTGCCGTCGAGCGACGACGACGCGCACGCCGCCAAAGAGGCGGTCCCAGAAGCAGAGACCAGGCCA
AGCATGGCGAGATACCTCCCTCTGTCCCACTGGCGGACGGTGCTCACGGTGCTGTCGCTGGCCATCGGGACGCTG
CTGGTGGCCATCGACACGACCATCATCAGCGTGGCAGTGCCGCGCATCGCGACCGACTTCGCCGCCTTCCACCAC
GTCGGCTACATGTACCGCTTCTTCGACGCCAAATGCATCTATCTGTCGTCGGTCGTCGTGTTCGAAGTCGGCTCC
GTCCTGTGTGCCGCCGCCCCGGTCTCGCCCGTCTTCATCCTCGGACGGGCCTTGCAGGGCATCGGCGCCGCCGGC
CTGTATCAAGGCGCCCTCTCCGTCATCGCCCTTACCGTCGCCCTGGACAAGCGACCGATGGTCATCGGCATCGTC
CTGAGCATCTTCGGCCTGGCCGTGTGCTTCGGGCCTCCGGTCGGCGGCGTGCTGACGGACGAGTACCTCTTCTAC
CTGCCCTTCTACTTCCAGTCGGCGCAAATGGTCGACGCGCGTGAAAGCGGCATCCGCGCCATACCGCTTGGGCTA
TCGCAAATCGTCTCCGTCGTCGTCTGCAGCGGTCTGGTTACCGCCTTCGGTCACTATGTTCCCTTCATGATTGCC
GGCCAGCTGGTGGCCATCGTCGGCAACGCCCTTCTCACGCGCATCCAAGTCGATACGCCGACAGCCGTCTGGGCC
ACGTACCTGGTCGTCACCGGCATCGGGACCGGCATGGGTCTTCAGACGCCCTTTACGGCAGTCCAGCTCGTGTTG
AGGTCGGTTCGTCATCTCTCGCTCCCGGGCTGCCCTGCTGATGCCAGGTTCAGCAAGGAAGACGTCCCCGTCGGA
AACGCCATCGTCGTCTTCTTCCAGCAACTCGGGGCGGCCGTCGCCGTCGCCGCCGGCCAAAGCATCTTTTCGAGC
GGCCTGCAAGACGAACTGACCAAAGGCAACATCCCGATTCCCGCTCGGGCGGTCCAGATGGCCGGGCCGACGGGC
ATTCGCACCCTGACGACCAATCCGGCACTGATTCGATTGATCCAAAACGCATACTGCTACGCTTTTCGCGACACC
ATGTATTTTGCTCTGGCCGCTCTCGTTGTCGCCATTCCCTTTGCTCTTCGGATGCAGTGGCTCAACGCAAGGGCG
GTGGCCAAGGCTGCGGCCGCCGAGGAACATGCCAGCTAG
Transcript >Hirsu2|7877
ATGTCGCCGCTGCCGTCGAGCGACGACGACGCGCACGCCGCCAAAGAGGCGGTCCCAGAAGCAGAGACCAGGCCA
AGCATGGCGAGATACCTCCCTCTGTCCCACTGGCGGACGGTGCTCACGGTGCTGTCGCTGGCCATCGGGACGCTG
CTGGTGGCCATCGACACGACCATCATCAGCGTGGCAGTGCCGCGCATCGCGACCGACTTCGCCGCCTTCCACCAC
GTCGGCTACATGTACCGCTTCTTCGACGCCAAATGCATCTATCTGTCGTCGGTCGTCGTGTTCGAAGTCGGCTCC
GTCCTGTGTGCCGCCGCCCCGGTCTCGCCCGTCTTCATCCTCGGACGGGCCTTGCAGGGCATCGGCGCCGCCGGC
CTGTATCAAGGCGCCCTCTCCGTCATCGCCCTTACCGTCGCCCTGGACAAGCGACCGATGGTCATCGGCATCGTC
CTGAGCATCTTCGGCCTGGCCGTGTGCTTCGGGCCTCCGGTCGGCGGCGTGCTGACGGACGAGTACCTCTTCTAC
CTGCCCTTCTACTTCCAGTCGGCGCAAATGGTCGACGCGCGTGAAAGCGGCATCCGCGCCATACCGCTTGGGCTA
TCGCAAATCGTCTCCGTCGTCGTCTGCAGCGGTCTGGTTACCGCCTTCGGTCACTATGTTCCCTTCATGATTGCC
GGCCAGCTGGTGGCCATCGTCGGCAACGCCCTTCTCACGCGCATCCAAGTCGATACGCCGACAGCCGTCTGGGCC
ACGTACCTGGTCGTCACCGGCATCGGGACCGGCATGGGTCTTCAGACGCCCTTTACGGCAGTCCAGCTCGTGTTG
AGGTCGGTTCGTCATCTCTCGCTCCCGGGCTGCCCTGCTGATGCCAGGTTCAGCAAGGAAGACGTCCCCGTCGGA
AACGCCATCGTCGTCTTCTTCCAGCAACTCGGGGCGGCCGTCGCCGTCGCCGCCGGCCAAAGCATCTTTTCGAGC
GGCCTGCAAGACGAACTGACCAAAGGCAACATCCCGATTCCCGCTCGGGCGGTCCAGATGGCCGGGCCGACGGGC
ATTCGCACCCTGACGACCAATCCGGCACTGATTCGATTGATCCAAAACGCATACTGCTACGCTTTTCGCGACACC
ATGTATTTTGCTCTGGCCGCTCTCGTTGTCGCCATTCCCTTTGCTCTTCGGATGCAGTGGCTCAACGCAAGGGCG
GTGGCCAAGGCTGCGGCCGCCGAGGAACATGCCAGCTAG
Gene >Hirsu2|7877
ATGTCGCCGCTGCCGTCGAGCGACGACGACGCGCACGCCGCCAAAGAGGCGGTCCCAGAAGCAGAGACCAGGCCA
AGCATGGCGAGATACCTCCCTCTGTCCCACTGGCGGACGGTGCTCACGGTGCTGTCGCTGGCCATCGGGACGCTG
CTGGTGGCCATCGACACGACCATCATCAGCGTGGCAGTGCCGCGCATCGCGACCGACTTCGCCGCCTTCCACCAC
GTCGGCTAGTACGGCTCGGCCTACCTATTCACCGTCACGGCCTTCCAGCCGGCCGTGGGAAGCATGTACCGCTTC
TTCGACGCCAAATGCATCTATCTGTCGTCGGTCGTCGTGTTCGAAGGTGAGGCCGGAGCAGATGGCCGATGACGA
CGGCGGAGAGCCGGTCCCGCTGATGCTTTGCGCAACCCGCACAGTCGGCTCCGTCCTGTGTGCCGCCGCCCCGGT
CTCGCCCGTCTTCATCCTCGGACGGGCCTTGCAGGGCATCGGCGCCGCCGGCCTGTATCAAGGCGCCCTCTCCGT
CATCGCCCTTACCGTCGCCCTGGACAAGCGACCGATGGTCATCGGCATCGTCCTGAGCATCTTCGGCCTGGCCGT
GTGCTTCGGGCCTCCGGTCGGCGGCGTGCTGACGGACGAGGTGACGTGGAGGTGGTGCTTCTGGATGTGCGTCCC
CCCTTTGGGCCTTTGGCCGCCCCCTGACCCTTATCCTGACCTGCCGCTCCATCGTGGACACTTTTCTATCGATAT
AGTACCTCTTCTACCTGCCCTTCTACTTCCAGTCGGCGCAAATGGTCGACGCGCGTGAAAGCGGCATCCGCGCCA
TACCGCTTGGGCTATCGCAAATCGTCTCCGTCGTCGTCTGCAGCGGTCTGGTTACCGCCTTCGGTCACTATGTAG
GTCCATACCGTCTGTCGCGATCCCCCTCGGCCGGTCTAGTCGAGAGACTGAGCGAGAGGTCAGGTTCCCTTCATG
ATTGCCGGCCAGCTGGTGGCCATCGTCGGCAACGCCCTTCTCACGCGCATCCAAGTCGATACGCCGACAGCCGTC
TGGGCCACGTACCTGGTCGTCACCGGCATCGGGACCGGCATGGGTCTTCAGACGCCCTTTACGGCAGTCCAGCTC
GTGTTGAGGTCGGTTCGTCATCTCTCGCTCCCGGGCTGCCCTGCTGATGCCAGGTTCAGCAAGGAAGACGTCCCC
GTCGGAAACGGTACGTAACCTGCACCGTTCTTCCAAGTGTCGAACAAAGCCGACTCACGAGGAATGGCAGCCATC
GTCGTCTTCTTCCAGCAACTCGGGGCGTAGGTTGGATTCCGGAACGTCCCGCCGGCATGCCGTGGCTGACCAGCT
CGCAGGGCCGTCGCCGTCGCCGCCGGCCAAAGCATCTTTTCGAGCGGCCTGCAAGACGAACTGACCAAAGGCAAC
ATCCCGATTCCCGCTCGGGCGGTCCAGATGGCCGGGCCGACGGGCATTCGCACCCTGACGACCAATCCGGCACTG
ATTCGATTGATCCAAAACGCATACTGCTACGCTTTTCGCGACACCATGTATTTTGCTCTGGCCGCTCTCGTTGTC
GCCATTCCCTTTGCTCTTCGGATGCAGTGGCTCAACGCAAGGGCGGTGGCCAAGGCTGCGGCCGCCGAGGAACAT
GCCAGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail