Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7871
Gene name
LocationContig_483:6194..7652
Strand-
Gene length (bp)1458
Transcript length (bp)1398
Coding sequence length (bp)1398
Protein length (aa) 466

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 1.1E-10 73 203
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 1.3E-10 241 350
PF07993 NAD_binding_4 Male sterility protein 1.0E-08 136 275
PF01370 Epimerase NAD dependent epimerase/dehydratase family 3.2E-06 73 291

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P14893|3BHS_BOVIN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Bos taurus GN=HSD3B PE=1 SV=2 73 453 3.0E-12
sp|A8DZE7|D42E1_DANRE Short-chain dehydrogenase/reductase family 42E member 1 OS=Danio rerio GN=sdr42e1 PE=2 SV=1 67 465 5.0E-12
sp|Q9EQC1|3BHS7_MOUSE 3 beta-hydroxysteroid dehydrogenase type 7 OS=Mus musculus GN=Hsd3b7 PE=1 SV=1 72 459 1.0E-11
sp|Q9D665|D42E1_MOUSE Short-chain dehydrogenase/reductase family 42E member 1 OS=Mus musculus GN=Sdr42e1 PE=1 SV=1 73 389 5.0E-11
sp|Q8WUS8|D42E1_HUMAN Short-chain dehydrogenase/reductase family 42E member 1 OS=Homo sapiens GN=SDR42E1 PE=2 SV=2 64 389 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P14893|3BHS_BOVIN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Bos taurus GN=HSD3B PE=1 SV=2 73 453 3.0E-12
sp|A8DZE7|D42E1_DANRE Short-chain dehydrogenase/reductase family 42E member 1 OS=Danio rerio GN=sdr42e1 PE=2 SV=1 67 465 5.0E-12
sp|Q9EQC1|3BHS7_MOUSE 3 beta-hydroxysteroid dehydrogenase type 7 OS=Mus musculus GN=Hsd3b7 PE=1 SV=1 72 459 1.0E-11
sp|Q9D665|D42E1_MOUSE Short-chain dehydrogenase/reductase family 42E member 1 OS=Mus musculus GN=Sdr42e1 PE=1 SV=1 73 389 5.0E-11
sp|Q8WUS8|D42E1_HUMAN Short-chain dehydrogenase/reductase family 42E member 1 OS=Homo sapiens GN=SDR42E1 PE=2 SV=2 64 389 1.0E-10
sp|Q0IH73|D42E1_XENLA Short-chain dehydrogenase/reductase family 42E member 1 OS=Xenopus laevis GN=sdr42e1 PE=2 SV=1 67 341 2.0E-10
sp|Q32L94|D42E1_BOVIN Short-chain dehydrogenase/reductase family 42E member 1 OS=Bos taurus GN=SDR42E1 PE=2 SV=2 73 389 2.0E-10
sp|Q4R7R1|D42E1_MACFA Short-chain dehydrogenase/reductase family 42E member 1 OS=Macaca fascicularis GN=SDR42E1 PE=2 SV=1 64 389 4.0E-10
sp|P9WQP7|3BHS_MYCTU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1106c PE=1 SV=1 71 290 7.0E-08
sp|P9WQP6|3BHS_MYCTO 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1137 PE=3 SV=1 71 290 7.0E-08
sp|O35048|3BHS7_RAT 3 beta-hydroxysteroid dehydrogenase type 7 OS=Rattus norvegicus GN=Hsd3b7 PE=2 SV=1 72 459 4.0E-07
sp|Q9H2F3|3BHS7_HUMAN 3 beta-hydroxysteroid dehydrogenase type 7 OS=Homo sapiens GN=HSD3B7 PE=1 SV=2 72 439 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0050662 coenzyme binding Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:0055114 oxidation-reduction process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:1901362 organic cyclic compound biosynthetic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0008202 steroid metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016229 steroid dehydrogenase activity No
GO:0016491 oxidoreductase activity No
GO:0048037 cofactor binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0008610 lipid biosynthetic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 5 22 17
2 72 94 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7871
MSATTVALLLLAAGLVLYGVRVNHVMLQTPPEAQAYLEPPLTADRVRQVYRRVKEQGIDWHAGLPPRRDRRYVIV
GGSGLVGGQIALSLLAVGVPPQAIRLLDIRPPTRSEFSSGAAAQVAFVKTDVTSEAEVESGMGASWAASVSGLPL
TVFHTAAVIRPQERDPVLYHRCSRVNVAGTAHALSAARKAGAGLFILTSSSNAGSRGVQWLFPPWRRQPRHFAQF
IGDDDFSAGRPGRAAHEFPSNYAASKAEAERLVCGSDAAEMRTAAIRPGNGVYGHRDDHIIAQMLGRPRMPTFAA
PWAQSWAHVGNVALAHLLLEAALLGPKADKVAGRPFMISDGGAPLRFRDVYTVLGATASTGFSVSHPPPVAMLLL
AYGVEAYCRLLARLPARLQGLVPEPGEPLCMLQPGTIASSVTSITDTSTARRRPDEGGLGYRPLCTTLEGLCAQV
RDWNEWVEAGGREER*
Coding >Hirsu2|7871
ATGAGCGCAACGACGGTCGCCCTGCTGCTCCTCGCGGCGGGCCTGGTGCTGTACGGCGTGCGGGTCAACCATGTC
ATGCTTCAGACTCCTCCCGAGGCTCAGGCCTACCTCGAGCCGCCCTTGACAGCGGATCGCGTTCGGCAGGTTTAC
CGACGGGTCAAGGAGCAGGGCATTGACTGGCATGCCGGCCTGCCGCCGCGGAGAGACAGGCGCTACGTCATCGTG
GGAGGCTCCGGGCTCGTGGGCGGGCAGATAGCTCTGAGCCTGCTGGCGGTGGGGGTGCCCCCGCAGGCCATCCGG
CTGCTCGACATTCGGCCGCCGACGCGGTCCGAGTTCTCGTCGGGCGCGGCGGCGCAGGTGGCCTTCGTCAAGACG
GACGTCACGTCCGAGGCCGAGGTCGAGAGCGGCATGGGGGCGTCGTGGGCAGCATCCGTCTCGGGCCTGCCGCTG
ACCGTCTTCCACACGGCGGCGGTAATCCGGCCGCAGGAGCGGGACCCGGTCTTGTACCACCGGTGCTCGCGCGTC
AACGTCGCCGGCACGGCGCACGCGCTGTCGGCGGCGCGCAAGGCGGGCGCGGGCCTCTTCATCCTCACGTCGAGC
TCCAACGCGGGCTCGAGGGGCGTGCAGTGGCTGTTCCCGCCGTGGAGGCGGCAGCCGCGGCACTTTGCGCAGTTC
ATCGGTGACGACGACTTCTCGGCCGGGCGACCGGGGCGGGCGGCGCACGAGTTCCCCAGCAACTACGCCGCGTCC
AAGGCGGAGGCGGAGCGGCTGGTGTGCGGGTCGGACGCGGCGGAGATGCGGACGGCGGCGATCCGGCCGGGCAAC
GGCGTCTACGGCCACCGCGACGACCACATCATCGCGCAGATGCTGGGGCGGCCGCGGATGCCGACGTTCGCGGCG
CCGTGGGCGCAGAGCTGGGCGCACGTCGGCAACGTGGCGCTGGCGCACCTGCTGCTCGAGGCGGCGCTGCTGGGC
CCGAAGGCGGACAAGGTGGCCGGGCGGCCGTTCATGATCTCGGACGGGGGCGCGCCGCTGCGCTTCCGCGACGTG
TACACGGTGCTGGGCGCGACGGCTTCGACGGGCTTCAGCGTCAGCCACCCGCCGCCGGTGGCGATGCTGCTGCTG
GCGTACGGCGTCGAGGCCTACTGCCGGCTGCTGGCGCGGCTGCCGGCGCGGCTGCAGGGCCTCGTGCCCGAGCCG
GGCGAGCCGCTGTGCATGCTGCAGCCGGGGACGATTGCGTCGTCGGTCACGTCCATCACCGACACGTCGACGGCC
CGGAGGCGGCCGGACGAGGGCGGGCTGGGCTACCGGCCGCTGTGCACGACGCTCGAGGGGCTCTGCGCCCAGGTC
CGCGACTGGAACGAATGGGTCGAGGCGGGCGGGCGAGAGGAGAGGTGA
Transcript >Hirsu2|7871
ATGAGCGCAACGACGGTCGCCCTGCTGCTCCTCGCGGCGGGCCTGGTGCTGTACGGCGTGCGGGTCAACCATGTC
ATGCTTCAGACTCCTCCCGAGGCTCAGGCCTACCTCGAGCCGCCCTTGACAGCGGATCGCGTTCGGCAGGTTTAC
CGACGGGTCAAGGAGCAGGGCATTGACTGGCATGCCGGCCTGCCGCCGCGGAGAGACAGGCGCTACGTCATCGTG
GGAGGCTCCGGGCTCGTGGGCGGGCAGATAGCTCTGAGCCTGCTGGCGGTGGGGGTGCCCCCGCAGGCCATCCGG
CTGCTCGACATTCGGCCGCCGACGCGGTCCGAGTTCTCGTCGGGCGCGGCGGCGCAGGTGGCCTTCGTCAAGACG
GACGTCACGTCCGAGGCCGAGGTCGAGAGCGGCATGGGGGCGTCGTGGGCAGCATCCGTCTCGGGCCTGCCGCTG
ACCGTCTTCCACACGGCGGCGGTAATCCGGCCGCAGGAGCGGGACCCGGTCTTGTACCACCGGTGCTCGCGCGTC
AACGTCGCCGGCACGGCGCACGCGCTGTCGGCGGCGCGCAAGGCGGGCGCGGGCCTCTTCATCCTCACGTCGAGC
TCCAACGCGGGCTCGAGGGGCGTGCAGTGGCTGTTCCCGCCGTGGAGGCGGCAGCCGCGGCACTTTGCGCAGTTC
ATCGGTGACGACGACTTCTCGGCCGGGCGACCGGGGCGGGCGGCGCACGAGTTCCCCAGCAACTACGCCGCGTCC
AAGGCGGAGGCGGAGCGGCTGGTGTGCGGGTCGGACGCGGCGGAGATGCGGACGGCGGCGATCCGGCCGGGCAAC
GGCGTCTACGGCCACCGCGACGACCACATCATCGCGCAGATGCTGGGGCGGCCGCGGATGCCGACGTTCGCGGCG
CCGTGGGCGCAGAGCTGGGCGCACGTCGGCAACGTGGCGCTGGCGCACCTGCTGCTCGAGGCGGCGCTGCTGGGC
CCGAAGGCGGACAAGGTGGCCGGGCGGCCGTTCATGATCTCGGACGGGGGCGCGCCGCTGCGCTTCCGCGACGTG
TACACGGTGCTGGGCGCGACGGCTTCGACGGGCTTCAGCGTCAGCCACCCGCCGCCGGTGGCGATGCTGCTGCTG
GCGTACGGCGTCGAGGCCTACTGCCGGCTGCTGGCGCGGCTGCCGGCGCGGCTGCAGGGCCTCGTGCCCGAGCCG
GGCGAGCCGCTGTGCATGCTGCAGCCGGGGACGATTGCGTCGTCGGTCACGTCCATCACCGACACGTCGACGGCC
CGGAGGCGGCCGGACGAGGGCGGGCTGGGCTACCGGCCGCTGTGCACGACGCTCGAGGGGCTCTGCGCCCAGGTC
CGCGACTGGAACGAATGGGTCGAGGCGGGCGGGCGAGAGGAGAGGTGA
Gene >Hirsu2|7871
ATGAGCGCAACGACGGTCGCCCTGCTGCTCCTCGCGGCGGGCCTGGTGCTGTACGGCGTGCGGGTCAACCATGTC
ATGCTTCAGACTCCTCCCGAGGCTCAGGCCTACCTCGAGCCGCCCTTGACAGCGGATCGCGTTCGGCAGGTTTAC
CGACGGGTCAAGGAGCAGGGCATTGACTGGCATGCCGGCCTGCCGCCGCGGAGAGACAGGCGCTACGTCATCGTG
GGAGGCTCCGGTGAGTTTCATGCGCTAGGCCGAGCTGCGCCGGAGACGCGAGCGCTGACCGCGCGTCCAGGGCTC
GTGGGCGGGCAGATAGCTCTGAGCCTGCTGGCGGTGGGGGTGCCCCCGCAGGCCATCCGGCTGCTCGACATTCGG
CCGCCGACGCGGTCCGAGTTCTCGTCGGGCGCGGCGGCGCAGGTGGCCTTCGTCAAGACGGACGTCACGTCCGAG
GCCGAGGTCGAGAGCGGCATGGGGGCGTCGTGGGCAGCATCCGTCTCGGGCCTGCCGCTGACCGTCTTCCACACG
GCGGCGGTAATCCGGCCGCAGGAGCGGGACCCGGTCTTGTACCACCGGTGCTCGCGCGTCAACGTCGCCGGCACG
GCGCACGCGCTGTCGGCGGCGCGCAAGGCGGGCGCGGGCCTCTTCATCCTCACGTCGAGCTCCAACGCGGGCTCG
AGGGGCGTGCAGTGGCTGTTCCCGCCGTGGAGGCGGCAGCCGCGGCACTTTGCGCAGTTCATCGGTGACGACGAC
TTCTCGGCCGGGCGACCGGGGCGGGCGGCGCACGAGTTCCCCAGCAACTACGCCGCGTCCAAGGCGGAGGCGGAG
CGGCTGGTGTGCGGGTCGGACGCGGCGGAGATGCGGACGGCGGCGATCCGGCCGGGCAACGGCGTCTACGGCCAC
CGCGACGACCACATCATCGCGCAGATGCTGGGGCGGCCGCGGATGCCGACGTTCGCGGCGCCGTGGGCGCAGAGC
TGGGCGCACGTCGGCAACGTGGCGCTGGCGCACCTGCTGCTCGAGGCGGCGCTGCTGGGCCCGAAGGCGGACAAG
GTGGCCGGGCGGCCGTTCATGATCTCGGACGGGGGCGCGCCGCTGCGCTTCCGCGACGTGTACACGGTGCTGGGC
GCGACGGCTTCGACGGGCTTCAGCGTCAGCCACCCGCCGCCGGTGGCGATGCTGCTGCTGGCGTACGGCGTCGAG
GCCTACTGCCGGCTGCTGGCGCGGCTGCCGGCGCGGCTGCAGGGCCTCGTGCCCGAGCCGGGCGAGCCGCTGTGC
ATGCTGCAGCCGGGGACGATTGCGTCGTCGGTCACGTCCATCACCGACACGTCGACGGCCCGGAGGCGGCCGGAC
GAGGGCGGGCTGGGCTACCGGCCGCTGTGCACGACGCTCGAGGGGCTCTGCGCCCAGGTCCGCGACTGGAACGAA
TGGGTCGAGGCGGGCGGGCGAGAGGAGAGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail