Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7869
Gene name
LocationContig_483:126..2133
Strand-
Gene length (bp)2007
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-27 76 480

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 6 553 3.0E-43
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 34 556 7.0E-39
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 7 248 3.0E-13
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 22 275 2.0E-12
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 55 305 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 6 553 3.0E-43
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 34 556 7.0E-39
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 7 248 3.0E-13
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 22 275 2.0E-12
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 55 305 4.0E-11
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 47 255 4.0E-11
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 22 248 5.0E-11
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 55 283 6.0E-11
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 27 280 7.0E-11
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 52 557 5.0E-10
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 23 261 1.0E-09
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 56 552 8.0E-09
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 38 325 1.0E-08
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 54 248 2.0E-08
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 5 280 2.0E-07
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 46 242 3.0E-07
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 55 272 5.0E-07
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 47 275 6.0E-06
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 47 275 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 70 92 22
2 107 129 22
3 136 153 17
4 168 190 22
5 197 216 19
6 226 245 19
7 357 379 22
8 384 406 22
9 427 446 19
10 461 483 22
11 495 514 19
12 524 546 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7869
MGLGVLEPKSAANVPGTTLYFDDPDRPREATGDDASLKCDRSGPVPIVLIPQPSDDPNDPLNWPLWQRDLITFTL
CFAGILAVCLGSILASNTLVLNAHFGVTLTKTAVLTGYFFLGTGVAAVFCVPSGRVWGKRHLFLIGICLVVLSTA
WAGSVGRSYGSMAAARAIQGAGAAPFESLLNAAVGDLYFVHQRGVRMAFTNLAIFGAAFLTPVVAGKATQSLGWP
WTFYLVCIFSAATLPLVFLLCPEVAYRRDTPLNLDAAVEESRLEPKSPSSAAVASPAADGARSRRPGFVLFPTSS
AMQPIGSAATPKKTFLQSLSLFDGRKTDESYAALLLRPFPLLLNPAFIWGCLIQGTMIGWTIFIGVLIAVVFIGP
PYFWGEVKTGYTYVGPFVGALVGFALAGALADSSVRVLTRLNRGIYEPEFRIWLTLPLLIIGGGGLYGFGLTVED
IATGKYHYSVPILFFGLQVAGMVIGTVASSLYVVDAYRDKTIEAFTLMIIFKNIFGFILTYYAFDWLVQSGFRLV
LVTVASVQVGICLLSIPMYVYGKRIRAFYHRPAA*
Coding >Hirsu2|7869
ATGGGCTTGGGAGTCCTCGAGCCCAAGTCGGCCGCCAATGTCCCTGGCACGACGCTCTACTTCGACGACCCGGAC
CGGCCTCGGGAGGCTACCGGCGACGACGCCTCGCTGAAATGCGACCGCAGCGGCCCCGTCCCCATCGTCCTCATT
CCCCAGCCGTCGGACGACCCCAACGACCCGCTCAACTGGCCGCTGTGGCAACGCGACCTCATCACCTTCACCCTC
TGCTTCGCCGGCATCCTGGCCGTCTGCCTCGGCTCCATCCTGGCCTCCAACACGCTCGTGCTCAACGCCCACTTC
GGCGTCACGCTGACCAAGACGGCCGTCCTGACCGGCTACTTCTTCCTCGGCACCGGCGTCGCCGCCGTCTTCTGC
GTCCCCTCGGGCCGCGTCTGGGGCAAGCGTCACCTGTTCCTGATCGGCATCTGCCTCGTCGTCCTCTCGACCGCC
TGGGCCGGCTCCGTCGGCAGAAGCTACGGCAGCATGGCCGCCGCCCGCGCCATCCAGGGCGCCGGCGCCGCCCCC
TTTGAGAGCCTGCTCAACGCCGCCGTCGGCGACCTGTACTTCGTCCACCAGCGAGGCGTCCGCATGGCCTTCACC
AACCTCGCCATCTTCGGCGCCGCCTTCCTGACCCCCGTCGTCGCCGGCAAGGCCACCCAGTCGCTCGGCTGGCCC
TGGACCTTCTACCTCGTCTGCATCTTCAGCGCCGCCACCCTGCCGCTCGTCTTCCTCCTCTGTCCCGAGGTGGCC
TACCGCCGTGACACGCCACTCAACCTGGACGCCGCCGTCGAGGAATCCCGCCTCGAGCCCAAGTCCCCCTCCTCC
GCCGCCGTCGCCTCCCCCGCGGCCGACGGCGCCCGCTCCCGCCGGCCCGGCTTCGTCCTCTTCCCCACCTCGTCC
GCCATGCAGCCCATCGGCAGCGCGGCCACGCCCAAGAAGACCTTCCTCCAGTCCCTGTCGCTCTTCGACGGCCGC
AAGACGGACGAGTCCTACGCCGCCCTCCTGCTGCGGCCCTTCCCCCTGCTCCTGAACCCGGCCTTCATCTGGGGC
TGCCTCATCCAGGGCACCATGATCGGCTGGACCATCTTCATCGGCGTCCTCATCGCCGTCGTCTTCATCGGGCCC
CCGTACTTCTGGGGCGAGGTCAAGACCGGCTACACCTACGTCGGGCCCTTCGTCGGCGCCCTCGTCGGCTTCGCC
CTCGCCGGCGCCCTCGCCGACAGCAGCGTCCGCGTCCTCACCCGGCTCAACAGGGGCATCTACGAGCCCGAGTTC
CGCATCTGGCTCACCCTCCCGCTGCTCATCATCGGCGGCGGCGGCCTGTACGGCTTCGGCCTGACGGTCGAAGAC
ATCGCCACCGGCAAGTACCACTACTCCGTCCCCATCCTCTTCTTCGGCCTCCAGGTGGCAGGCATGGTCATCGGT
ACCGTGGCCAGCTCCCTCTACGTTGTCGACGCCTATCGCGACAAGACAATCGAGGCCTTCACCCTCATGATCATC
TTCAAGAACATTTTCGGCTTCATCCTCACCTACTACGCCTTCGACTGGCTCGTCCAGAGCGGCTTCCGCCTGGTC
CTGGTGACCGTCGCCTCCGTCCAGGTCGGCATCTGCCTGCTCAGCATCCCGATGTACGTGTACGGGAAGCGCATC
CGCGCCTTCTACCACCGGCCGGCCGCCTGA
Transcript >Hirsu2|7869
ATGGGCTTGGGAGTCCTCGAGCCCAAGTCGGCCGCCAATGTCCCTGGCACGACGCTCTACTTCGACGACCCGGAC
CGGCCTCGGGAGGCTACCGGCGACGACGCCTCGCTGAAATGCGACCGCAGCGGCCCCGTCCCCATCGTCCTCATT
CCCCAGCCGTCGGACGACCCCAACGACCCGCTCAACTGGCCGCTGTGGCAACGCGACCTCATCACCTTCACCCTC
TGCTTCGCCGGCATCCTGGCCGTCTGCCTCGGCTCCATCCTGGCCTCCAACACGCTCGTGCTCAACGCCCACTTC
GGCGTCACGCTGACCAAGACGGCCGTCCTGACCGGCTACTTCTTCCTCGGCACCGGCGTCGCCGCCGTCTTCTGC
GTCCCCTCGGGCCGCGTCTGGGGCAAGCGTCACCTGTTCCTGATCGGCATCTGCCTCGTCGTCCTCTCGACCGCC
TGGGCCGGCTCCGTCGGCAGAAGCTACGGCAGCATGGCCGCCGCCCGCGCCATCCAGGGCGCCGGCGCCGCCCCC
TTTGAGAGCCTGCTCAACGCCGCCGTCGGCGACCTGTACTTCGTCCACCAGCGAGGCGTCCGCATGGCCTTCACC
AACCTCGCCATCTTCGGCGCCGCCTTCCTGACCCCCGTCGTCGCCGGCAAGGCCACCCAGTCGCTCGGCTGGCCC
TGGACCTTCTACCTCGTCTGCATCTTCAGCGCCGCCACCCTGCCGCTCGTCTTCCTCCTCTGTCCCGAGGTGGCC
TACCGCCGTGACACGCCACTCAACCTGGACGCCGCCGTCGAGGAATCCCGCCTCGAGCCCAAGTCCCCCTCCTCC
GCCGCCGTCGCCTCCCCCGCGGCCGACGGCGCCCGCTCCCGCCGGCCCGGCTTCGTCCTCTTCCCCACCTCGTCC
GCCATGCAGCCCATCGGCAGCGCGGCCACGCCCAAGAAGACCTTCCTCCAGTCCCTGTCGCTCTTCGACGGCCGC
AAGACGGACGAGTCCTACGCCGCCCTCCTGCTGCGGCCCTTCCCCCTGCTCCTGAACCCGGCCTTCATCTGGGGC
TGCCTCATCCAGGGCACCATGATCGGCTGGACCATCTTCATCGGCGTCCTCATCGCCGTCGTCTTCATCGGGCCC
CCGTACTTCTGGGGCGAGGTCAAGACCGGCTACACCTACGTCGGGCCCTTCGTCGGCGCCCTCGTCGGCTTCGCC
CTCGCCGGCGCCCTCGCCGACAGCAGCGTCCGCGTCCTCACCCGGCTCAACAGGGGCATCTACGAGCCCGAGTTC
CGCATCTGGCTCACCCTCCCGCTGCTCATCATCGGCGGCGGCGGCCTGTACGGCTTCGGCCTGACGGTCGAAGAC
ATCGCCACCGGCAAGTACCACTACTCCGTCCCCATCCTCTTCTTCGGCCTCCAGGTGGCAGGCATGGTCATCGGT
ACCGTGGCCAGCTCCCTCTACGTTGTCGACGCCTATCGCGACAAGACAATCGAGGCCTTCACCCTCATGATCATC
TTCAAGAACATTTTCGGCTTCATCCTCACCTACTACGCCTTCGACTGGCTCGTCCAGAGCGGCTTCCGCCTGGTC
CTGGTGACCGTCGCCTCCGTCCAGGTCGGCATCTGCCTGCTCAGCATCCCGATGTACGTGTACGGGAAGCGCATC
CGCGCCTTCTACCACCGGCCGGCCGCCTGA
Gene >Hirsu2|7869
ATGGGCTTGGGAGTCCTCGAGCCCAAGTCGGCCGCCAATGTCCCTGGTAGCTCCGCCCCGGCTTCGCCACCCTCA
AGCTAAACCCCCCTGTCACGATGGCCTCACGAACGGGGCCGCTGTGGGGAGAGGCTCTGGCACGCTTCGCACGGA
CACTACCAAGGCTGACCCGGCCCCAGGCACGACGCTCTACTTCGACGACCCGGACCGGCCTCGGGAGGCTACCGG
CGACGACGCCTCGCTGAAATGCGACCGCAGCGGCCCCGTCCCCATCGTCCTCGTGCGTTTGGATGCCCTCCCTCT
CTTACGAGCCGCCGACGACTGACCTGCGTCGCCGTCGCGGATCGCAGATTCCCCAGCCGTCGGACGACCCCAACG
ACCCGCTCAACTGGCCGCTGTGGCAACGCGACCTCATCACCTTCACCCTCTGCTTCGCCGGCATCCTGGCCGTCT
GCCTCGGCTCCATCCTGGCCTCCAACACGCTCGTGCTCAACGCCCACTTCGGCGTCACGCTGACCAAGACGGCCG
TCCTGACCGGCTACTTCTTCCTCGGCACCGGCGTCGCCGCCGTCTTCTGCGTCCCCTCGGGCCGCGTCTGGGGCA
AGCGTCACCTGTTCCTGATCGGCATCTGCCTCGTCGTCCTCTCGACCGCCTGGGCCGGCTCCGTCGGCAGAAGCT
ACGGCAGCATGGCCGCCGCCCGCGCCATCCAGGGCGCCGGCGCCGCCCCCTTTGAGAGCCTGCTCAACGCCGCCG
TCGGCGACCTGTACTTCGTCCACCAGCGAGGCGTCCGCATGGCCTTCACCAACCTCGCCATCTTCGGCGCCGCCT
TCCTGACCCCCGTCGTCGCCGGCAAGGCCACCCAGTCGCTCGGCTGGCCCTGGACCTTCTACCTCGTCTGCATCT
TCAGCGCCGCCACCCTGCCGCTCGTCTTCCTCCTCTGTCCCGAGGTGGCCTACCGCCGTGACACGCCACTCAACC
TGGACGCCGCCGTCGAGGAATCCCGCCTCGAGCCCAAGTCCCCCTCCTCCGCCGCCGTCGCCTCCCCCGCGGCCG
ACGGCGCCCGCTCCCGCCGGCCCGGCTTCGTCCTCTTCCCCACCTCGTCCGCCATGCAGCCCATCGGCAGCGCGG
CCACGCCCAAGAAGACCTTCCTCCAGTCCCTGTCGCTCTTCGACGGCCGCAAGACGGACGAGTCCTACGCCGCCC
TCCTGCTGCGGCCCTTCCCCCTGCTCCTGAACCCGGCCTTCATCTGGGGCTGCCTCATCCAGGGCACCATGATCG
GCTGGACCATCTTCATCGGCGTCCTCATCGCCGTCGTCTTCATCGGGCCCCCGTACTTCTGGGGCGAGGTCAAGA
CCGGCTACACCTACGTCGGGCCCTTCGTCGGCGCCCTCGTCGGCTTCGCCCTCGCCGGCGCCCTCGCCGACAGCA
GCGTCCGCGTCCTCACCCGGCTCAACAGGGGCATCTACGAGCCCGAGTTCCGCATCTGGCTCACCCTCCCGCTGC
TCATCATCGGCGGCGGCGGCCTGTACGGCTTCGGCCTGACGGTCGAAGACATCGCCACCGGCAAGTACCACTACT
CCGTCCCCATCCTCTTCTTCGGCCTCCAGGTGGCAGGCATGGTCATCGGTACCGTGGCCAGCTCCCTCTACGTTG
TCGACGCCTATCGTGAGTCGTCTTCCCCCCTCCCTTTCCTCGCCGAATCCGTGACTCACACCTGGGCTCCACGTA
CGTCACGGCGCAGGCGACAAGACAATCGAGGCCTTCACCCTCATGATCATCTTCAAGAACATTTTCGGCTTCATC
CTCACCTACTACGCCTTCGACTGGCTCGTCCAGAGCGGCTTCCGCCTGGTCCTGGTGACCGTCGCCTCCGTCCAG
GTCGGCATCTGCCTGCTCAGCATCCCGATGTGTGAGTGTGCCGCGCGCCGCCGCAGCTCGACGTGGCTGACCTGC
GCCGCAGACGTGTACGGGAAGCGCATCCGCGCCTTCTACCACCGGCCGGCCGCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail