Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7862
Gene name
LocationContig_481:15526..16464
Strand+
Gene length (bp)938
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18265 Nas2_N Nas2 N_terminal domain 3.2E-29 36 113
PF17820 PDZ_6 PDZ domain 2.0E-06 148 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3SZ19|PSMD9_BOVIN 26S proteasome non-ATPase regulatory subunit 9 OS=Bos taurus GN=PSMD9 PE=1 SV=1 21 236 1.0E-42
sp|Q9WTV5|PSMD9_RAT 26S proteasome non-ATPase regulatory subunit 9 OS=Rattus norvegicus GN=Psmd9 PE=1 SV=1 35 236 8.0E-40
sp|O00233|PSMD9_HUMAN 26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens GN=PSMD9 PE=1 SV=3 21 236 8.0E-39
sp|Q9CR00|PSMD9_MOUSE 26S proteasome non-ATPase regulatory subunit 9 OS=Mus musculus GN=Psmd9 PE=1 SV=1 38 236 5.0E-38
sp|Q9VFS8|PSMD9_DROME 26S proteasome non-ATPase regulatory subunit 9 OS=Drosophila melanogaster GN=CG9588 PE=1 SV=1 28 234 2.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3SZ19|PSMD9_BOVIN 26S proteasome non-ATPase regulatory subunit 9 OS=Bos taurus GN=PSMD9 PE=1 SV=1 21 236 1.0E-42
sp|Q9WTV5|PSMD9_RAT 26S proteasome non-ATPase regulatory subunit 9 OS=Rattus norvegicus GN=Psmd9 PE=1 SV=1 35 236 8.0E-40
sp|O00233|PSMD9_HUMAN 26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens GN=PSMD9 PE=1 SV=3 21 236 8.0E-39
sp|Q9CR00|PSMD9_MOUSE 26S proteasome non-ATPase regulatory subunit 9 OS=Mus musculus GN=Psmd9 PE=1 SV=1 38 236 5.0E-38
sp|Q9VFS8|PSMD9_DROME 26S proteasome non-ATPase regulatory subunit 9 OS=Drosophila melanogaster GN=CG9588 PE=1 SV=1 28 234 2.0E-29
sp|P40555|PSMD9_YEAST Probable 26S proteasome regulatory subunit p27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS2 PE=1 SV=1 35 236 6.0E-29
sp|O94393|PSMD9_SCHPO Probable 26S proteasome regulatory subunit p27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nas2 PE=3 SV=1 35 233 9.0E-26
sp|Q10920|PSMD9_CAEEL Probable 26S proteasome non-ATPase regulatory subunit 9 OS=Caenorhabditis elegans GN=psmd-9 PE=1 SV=2 38 236 9.0E-24
sp|Q552Y8|PSMD9_DICDI Probable 26S proteasome non-ATPase regulatory subunit 9 OS=Dictyostelium discoideum GN=psmD9 PE=2 SV=1 35 236 2.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7862
MGLPLRMNNLHAPTVSSGPTSAAAASNGRGSPPSLAALQRQKDELEAELKALGGVLDSHGVNMDTPLLTRDGFPR
ADVDVAQIRTTRARIIRLRNDYKDVMSSIEKCVHMHFASLDDANDLSAPGSGAQLLSSDAEAGAAAREPFAKINT
VSPGSPAERSGLRPGDEIRVFGYVDRDNHDGLKKVAECVQGNEGRDVFIRVSRPTGAAQRQELRLTLRPTRDWGG
RGLLGCHILPL*
Coding >Hirsu2|7862
ATGGGCCTGCCGCTCAGGATGAACAACCTGCACGCGCCGACCGTGTCGTCCGGGCCGACGAGCGCTGCGGCAGCC
AGCAACGGACGCGGCAGCCCGCCGAGCCTCGCGGCGCTGCAGCGGCAGAAGGACGAGCTCGAGGCCGAGCTCAAG
GCTCTGGGCGGCGTGCTCGATTCGCATGGAGTCAACATGGACACGCCCCTCCTGACCAGGGACGGCTTTCCCCGC
GCAGACGTCGACGTGGCCCAGATCAGGACTACGAGGGCGCGCATCATCAGGCTGCGGAATGACTACAAAGACGTC
ATGAGCAGCATCGAAAAGTGCGTTCACATGCATTTTGCCAGCCTCGACGACGCAAACGACCTGTCAGCCCCAGGC
TCGGGCGCCCAGCTGCTGTCGTCGGACGCAGAGGCCGGAGCCGCGGCCCGCGAGCCATTCGCCAAGATCAACACG
GTATCCCCCGGCAGCCCGGCGGAGCGTTCCGGGCTGCGGCCGGGCGACGAGATCCGCGTCTTCGGCTACGTCGAC
CGAGACAACCACGACGGCCTCAAGAAGGTGGCCGAGTGCGTGCAGGGCAACGAGGGGCGCGACGTCTTCATCCGG
GTGTCGCGGCCGACGGGCGCGGCACAACGACAAGAGCTGCGTTTGACGCTGAGGCCGACGCGCGATTGGGGCGGC
CGCGGTTTGTTGGGCTGTCACATTTTGCCCCTTTGA
Transcript >Hirsu2|7862
ATGGGCCTGCCGCTCAGGATGAACAACCTGCACGCGCCGACCGTGTCGTCCGGGCCGACGAGCGCTGCGGCAGCC
AGCAACGGACGCGGCAGCCCGCCGAGCCTCGCGGCGCTGCAGCGGCAGAAGGACGAGCTCGAGGCCGAGCTCAAG
GCTCTGGGCGGCGTGCTCGATTCGCATGGAGTCAACATGGACACGCCCCTCCTGACCAGGGACGGCTTTCCCCGC
GCAGACGTCGACGTGGCCCAGATCAGGACTACGAGGGCGCGCATCATCAGGCTGCGGAATGACTACAAAGACGTC
ATGAGCAGCATCGAAAAGTGCGTTCACATGCATTTTGCCAGCCTCGACGACGCAAACGACCTGTCAGCCCCAGGC
TCGGGCGCCCAGCTGCTGTCGTCGGACGCAGAGGCCGGAGCCGCGGCCCGCGAGCCATTCGCCAAGATCAACACG
GTATCCCCCGGCAGCCCGGCGGAGCGTTCCGGGCTGCGGCCGGGCGACGAGATCCGCGTCTTCGGCTACGTCGAC
CGAGACAACCACGACGGCCTCAAGAAGGTGGCCGAGTGCGTGCAGGGCAACGAGGGGCGCGACGTCTTCATCCGG
GTGTCGCGGCCGACGGGCGCGGCACAACGACAAGAGCTGCGTTTGACGCTGAGGCCGACGCGCGATTGGGGCGGC
CGCGGTTTGTTGGGCTGTCACATTTTGCCCCTTTGA
Gene >Hirsu2|7862
ATGGGCCTGCCGCTCAGGATGAACAACCTGCACGCGCCGACCGTGTCGTCCGGGCCGACGAGCGCTGCGGCAGCC
AGCAACGGACGCGGCAGCCCGCCGAGCCTCGCGGCGCTGCAGCGGCAGAAGGACGAGCTCGAGGCCGAGCTCAAG
GCTCTGGGCGGCGTGCTCGATTCGGTGCGTCCCCAAGCACGGCCGGCGCAGGCGAGGGCCAGAAAGCTCAAAGTC
GGCTGACGGGCATGCCTGCAGCATGGAGTCAACATGGACACGCCCCTCCTGACCAGGGACGGCTTTCCCCGCGCA
GACGTCGACGTGGCCCAGAGTAGGACATCATGATGAAACCAGCTTGGGGGGGCAGCCCCCGTCGCGCAGCTCGTG
CGTGGCGATAGGTCGCGGCGGGTTCGACTGACTCGATGGCAGTCAGGACTACGAGGGCGCGCATCATCAGGCTGC
GGAATGACTACAAAGACGTCATGAGCAGCATCGAAAAGTGCGTTCACATGCATTTTGCCAGCCTCGACGACGCAA
ACGACCTGTCAGCCCCAGGCTCGGGCGCCCAGCTGCTGTCGTCGGACGCAGAGGCCGGAGCCGCGGCCCGCGAGC
CATTCGCCAAGATCAACACGGTATCCCCCGGCAGCCCGGCGGAGCGTTCCGGGCTGCGGCCGGGCGACGAGATCC
GCGTCTTCGGCTACGTCGACCGAGACAACCACGACGGCCTCAAGAAGGTGGCCGAGTGCGTGCAGGGCAACGAGG
GGGTAAGTCTGCGCGACTCGGGCCGTCTGGTCCCGGCCGTTGACATTTCGGGCTCCCAGCGCGACGTCTTCATCC
GGGTGTCGCGGCCGACGGGCGCGGCACAACGACAAGAGCTGCGTTTGACGCTGAGGCCGACGCGCGATTGGGGCG
GCCGCGGTTTGTTGGGCTGTCACATTTTGCCCCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail