Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7860
Gene name
LocationContig_481:11457..12219
Strand+
Gene length (bp)762
Transcript length (bp)519
Coding sequence length (bp)519
Protein length (aa) 173

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01480 PWI PWI domain 2.5E-29 32 102

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USH5|YJQ5_SCHPO PWI domain-containing protein C825.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC825.05c PE=1 SV=1 1 160 4.0E-22
sp|Q5ZMJ9|SRRM1_CHICK Serine/arginine repetitive matrix protein 1 OS=Gallus gallus GN=SRRM1 PE=2 SV=1 19 141 4.0E-22
sp|Q52KI8|SRRM1_MOUSE Serine/arginine repetitive matrix protein 1 OS=Mus musculus GN=Srrm1 PE=1 SV=2 19 118 1.0E-21
sp|Q5R5Q2|SRRM1_PONAB Serine/arginine repetitive matrix protein 1 OS=Pongo abelii GN=SRRM1 PE=2 SV=1 19 118 2.0E-21
sp|Q8IYB3|SRRM1_HUMAN Serine/arginine repetitive matrix protein 1 OS=Homo sapiens GN=SRRM1 PE=1 SV=2 19 118 2.0E-21

GO

GO Term Description Terminal node
GO:0006397 mRNA processing Yes
GO:0046483 heterocycle metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0008152 metabolic process No
GO:0006396 RNA processing No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0016071 mRNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7860
MASKVDARLLKSTKFPPEFDQKVDVEKVNMHVLKKWIEKRVFEILGNDDDVLTELCCNLIQGSRYPDIKSIQIQL
TGFLDKDTALFCKELWNLLLSGQSSPQGVPKELLEAKKLELMQEKKMDADRENARRGREPQDPREQEPRESRQSW
QRRLRPLRTSFAVSQTPRSWPS*
Coding >Hirsu2|7860
ATGGCGTCAAAGGTCGACGCTCGACTCTTGAAGTCGACCAAATTTCCGCCCGAGTTCGACCAGAAGGTGGACGTG
GAGAAGGTCAACATGCACGTTTTGAAAAAATGGATTGAGAAGAGAGTTTTCGAGATTTTGGGAAACGACGACGAC
GTGTTGACGGAGCTCTGTTGCAACCTCATTCAAGGCTCGCGATACCCTGACATCAAGTCAATCCAGATACAACTC
ACCGGATTTCTCGATAAAGACACCGCTTTGTTTTGCAAGGAGCTCTGGAACCTACTCCTAAGCGGCCAGAGCAGT
CCCCAAGGCGTGCCTAAGGAGCTACTCGAGGCTAAGAAGCTCGAGCTCATGCAGGAGAAGAAGATGGACGCCGAT
CGGGAAAATGCCCGTCGTGGCCGCGAACCTCAGGACCCCAGGGAGCAAGAGCCCCGAGAGTCGAGACAATCGTGG
CAGAGGCGGCTACGGCCGCTTCGGACGTCGTTCGCCGTCTCCCAGACCCCGAGGTCGTGGCCCTCGTGA
Transcript >Hirsu2|7860
ATGGCGTCAAAGGTCGACGCTCGACTCTTGAAGTCGACCAAATTTCCGCCCGAGTTCGACCAGAAGGTGGACGTG
GAGAAGGTCAACATGCACGTTTTGAAAAAATGGATTGAGAAGAGAGTTTTCGAGATTTTGGGAAACGACGACGAC
GTGTTGACGGAGCTCTGTTGCAACCTCATTCAAGGCTCGCGATACCCTGACATCAAGTCAATCCAGATACAACTC
ACCGGATTTCTCGATAAAGACACCGCTTTGTTTTGCAAGGAGCTCTGGAACCTACTCCTAAGCGGCCAGAGCAGT
CCCCAAGGCGTGCCTAAGGAGCTACTCGAGGCTAAGAAGCTCGAGCTCATGCAGGAGAAGAAGATGGACGCCGAT
CGGGAAAATGCCCGTCGTGGCCGCGAACCTCAGGACCCCAGGGAGCAAGAGCCCCGAGAGTCGAGACAATCGTGG
CAGAGGCGGCTACGGCCGCTTCGGACGTCGTTCGCCGTCTCCCAGACCCCGAGGTCGTGGCCCTCGTGA
Gene >Hirsu2|7860
ATGGCGTCAAAGGTCGACGCTCGACTCTTGAAGTCGACCAAATTTCCGCCCGAGTTCGACCAGAAGGTGGACGTG
GAGAAGGTCAACATGCACGTTTTGAAAAAGTTGGTTCTGCCCGTCCACGCTTCTCCCCCACACCTCTCACCTACG
CCCTCGTGCTGACTTGTGCTGCTGCAGATGGATTGAGAAGAGAGTTTTCGAGATTTTGGGAAACGACGACGACGT
GTTGACGGAGCTCTGTTGCAACCTCATTCAAGGCTCGCGATACGTTCGTTTGCCCCGACGACCCGCCCGGATGCA
GGATCCTCAGCTGACTCTTTACACCAGCCTGACATCAAGTCAATCCAGATACAACTCACCGGATTTCTCGATAAA
GACACCGCTTTGTTTTGCAAGGAGCTCTGGAACCTACTCCTAAGCGGCCAGAGCAGTCCCCAAGGCGTGCCTAAG
GAGCTACTCGAGGCTAAGAAGCTCGAGCTCATGCAGGAGAAGAAGGTACACGTCGATGCCCTGAAGCCATGGCTG
CGGCTCGTGCTAATGTCGCACCTGGTAGATGGACGCCGATCGGGAAAATGCCCGTCGTGGCCGCGAACCTCAGGA
CCCCAGGGAGCAAGAGCCCCGAGAGTCGAGACAAGTTGCAGATTCTTGGCACGCACAGGGACGGCGAGGCGACCG
CTCCTTCGGCAGTCGTGGCAGAGGCGGCTACGGCCGCTTCGGACGTCGTTCGCCGTCTCCCAGACCCCGAGGTCG
TGGCCCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail