Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7854
Gene name
LocationContig_480:6396..8358
Strand+
Gene length (bp)1962
Transcript length (bp)1908
Coding sequence length (bp)1908
Protein length (aa) 636

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08317 Spc7 Spc7 kinetochore protein 4.0E-127 142 452
PF15402 Spc7_N N-terminus of kinetochore NMS complex subunit Spc7 3.7E-34 1 72
PF15577 Spc7_C2 Spc7_C2 4.4E-20 511 570

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59757|SPC7_SCHPO Kinetochore protein spc7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spc7 PE=1 SV=1 144 435 2.0E-31
sp|P53148|SP105_YEAST Spindle pole body component SPC105 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC105 PE=1 SV=1 190 462 2.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7854
MINSLSPKWKPLRGRKSLHVGSAKGLLGKRPSELDEDEEAEDDDGVKRLKGHQGSPVKNVRLQQPPSKSETVGRL
TRSGRKSLEHGNGVSTPSLSSPVKQAATTPQNQGRFKDVGGSKTIHEINFQDSCVVKNEAELENDIEEEKIHLQD
FLNMISIRFMELTTTKRRHTIAPGNGQDGTVADGQDDLSLERCVVAGACTVPMLELYQHSCRELKKYISEGRRMV
KEIENETFEENPPLFREYMSASPDVKALMDNQFKNVKTHARLLSKAMWYEWRMKLQDGLKEGLVSLAEGMDRDDR
VLQEQQDALTLVLPAVVARYESLSREHSNLQEAARELADCDPGELTSARQELRNLDADIARKKQRIAELRGRFEN
SSTEVEELSQRKAKCMEEIESCERVREQYRGWTSREVNGLKARVETIEKEHGWAVTGLSGTSLSMSYRREIELVF
DIVSFQHDGSSSSLDLWYIADKREKQAIPKTTEHEFFLQCIRDHVRTLSQSGRGRTKISELLGIIRAGWDKARLV
SSAISRINIVFPTRVEKKSDTSISVTSSVLLVPLQTKVEVTLVLRGCSGPSGVDVGISVEANVVYGEHFNVAKIG
EFLTTRIGGRVGEGSEDWSEVMMELQRKLIATGRK*
Coding >Hirsu2|7854
ATGATCAACAGTCTGAGCCCGAAATGGAAACCTTTGAGAGGCAGGAAGAGTCTCCATGTCGGAAGCGCCAAAGGC
TTGCTGGGCAAGCGACCTTCCGAGCTCGATGAGGACGAGGAAGCTGAAGATGACGACGGAGTGAAGAGGCTTAAG
GGGCATCAGGGCAGCCCGGTCAAGAATGTTCGACTGCAACAGCCGCCGTCGAAGTCCGAGACTGTTGGGCGACTC
ACGAGATCAGGGCGAAAGAGCCTCGAGCACGGCAACGGTGTTTCGACGCCCTCGCTTTCGTCTCCCGTCAAGCAA
GCAGCCACTACGCCACAGAACCAGGGGCGTTTCAAGGATGTCGGAGGCAGCAAGACTATACACGAAATCAATTTC
CAGGACTCGTGCGTCGTCAAGAATGAGGCCGAGCTTGAGAATGATATTGAAGAGGAGAAGATCCACCTTCAAGAT
TTCTTGAACATGATCTCAATTCGCTTCATGGAACTGACGACGACGAAGCGCCGCCATACGATTGCTCCAGGTAAT
GGCCAGGACGGCACTGTGGCTGACGGGCAAGACGATCTTTCGCTGGAGCGCTGTGTCGTTGCGGGTGCTTGTACT
GTTCCCATGCTTGAGCTGTACCAGCACTCATGCAGGGAGCTCAAAAAGTACATTTCCGAAGGCCGGCGAATGGTG
AAAGAGATCGAGAACGAGACATTTGAGGAGAACCCACCGCTCTTCCGCGAGTACATGTCAGCCTCACCGGACGTC
AAGGCACTCATGGACAACCAATTCAAAAACGTCAAGACACATGCTCGGCTCTTGAGCAAAGCAATGTGGTACGAG
TGGCGAATGAAGTTGCAGGATGGTCTCAAGGAAGGACTCGTGAGCCTGGCTGAGGGGATGGACAGAGACGACAGG
GTCCTTCAAGAGCAGCAGGACGCGTTGACATTGGTCTTGCCGGCCGTAGTGGCGCGTTACGAATCCCTGTCGAGG
GAGCACAGCAATTTGCAAGAGGCCGCTCGAGAGCTGGCTGATTGCGACCCGGGCGAGCTGACGTCTGCTCGGCAA
GAGCTGAGAAACCTGGACGCAGACATCGCTCGGAAGAAGCAACGGATCGCTGAGCTTCGAGGGCGATTTGAGAAC
TCGTCGACAGAGGTGGAGGAGCTTAGCCAGAGAAAGGCGAAGTGCATGGAAGAAATCGAGTCGTGTGAAAGAGTC
CGAGAGCAGTACCGTGGCTGGACAAGCCGAGAGGTCAACGGACTGAAAGCTCGGGTCGAGACCATCGAGAAGGAG
CACGGATGGGCAGTCACAGGGCTCTCCGGGACGAGCCTTTCGATGAGCTACAGGCGGGAAATTGAACTCGTGTTC
GATATCGTCTCCTTCCAGCACGATGGCTCGTCATCTTCCCTGGACCTCTGGTACATCGCCGATAAACGAGAGAAG
CAGGCGATTCCGAAGACGACGGAACACGAGTTCTTCCTCCAGTGCATTCGCGACCACGTTCGGACGTTGTCGCAG
AGCGGGCGGGGCAGGACAAAAATATCCGAGCTCCTTGGCATAATTCGGGCCGGGTGGGACAAGGCCCGGCTGGTG
TCATCTGCAATCAGCCGCATCAACATCGTCTTCCCCACTAGGGTGGAGAAAAAGTCCGATACAAGCATCAGCGTG
ACGAGCTCGGTGCTGCTGGTGCCCCTGCAAACCAAGGTCGAAGTCACTTTGGTACTACGAGGCTGCAGCGGCCCG
TCTGGGGTAGACGTGGGGATATCTGTGGAGGCAAACGTTGTGTATGGGGAGCACTTTAACGTGGCCAAGATTGGC
GAGTTCCTGACGACGAGGATTGGCGGGCGGGTTGGCGAGGGGAGCGAGGATTGGAGCGAGGTGATGATGGAGCTG
CAGCGGAAGCTGATTGCCACTGGCAGGAAGTGA
Transcript >Hirsu2|7854
ATGATCAACAGTCTGAGCCCGAAATGGAAACCTTTGAGAGGCAGGAAGAGTCTCCATGTCGGAAGCGCCAAAGGC
TTGCTGGGCAAGCGACCTTCCGAGCTCGATGAGGACGAGGAAGCTGAAGATGACGACGGAGTGAAGAGGCTTAAG
GGGCATCAGGGCAGCCCGGTCAAGAATGTTCGACTGCAACAGCCGCCGTCGAAGTCCGAGACTGTTGGGCGACTC
ACGAGATCAGGGCGAAAGAGCCTCGAGCACGGCAACGGTGTTTCGACGCCCTCGCTTTCGTCTCCCGTCAAGCAA
GCAGCCACTACGCCACAGAACCAGGGGCGTTTCAAGGATGTCGGAGGCAGCAAGACTATACACGAAATCAATTTC
CAGGACTCGTGCGTCGTCAAGAATGAGGCCGAGCTTGAGAATGATATTGAAGAGGAGAAGATCCACCTTCAAGAT
TTCTTGAACATGATCTCAATTCGCTTCATGGAACTGACGACGACGAAGCGCCGCCATACGATTGCTCCAGGTAAT
GGCCAGGACGGCACTGTGGCTGACGGGCAAGACGATCTTTCGCTGGAGCGCTGTGTCGTTGCGGGTGCTTGTACT
GTTCCCATGCTTGAGCTGTACCAGCACTCATGCAGGGAGCTCAAAAAGTACATTTCCGAAGGCCGGCGAATGGTG
AAAGAGATCGAGAACGAGACATTTGAGGAGAACCCACCGCTCTTCCGCGAGTACATGTCAGCCTCACCGGACGTC
AAGGCACTCATGGACAACCAATTCAAAAACGTCAAGACACATGCTCGGCTCTTGAGCAAAGCAATGTGGTACGAG
TGGCGAATGAAGTTGCAGGATGGTCTCAAGGAAGGACTCGTGAGCCTGGCTGAGGGGATGGACAGAGACGACAGG
GTCCTTCAAGAGCAGCAGGACGCGTTGACATTGGTCTTGCCGGCCGTAGTGGCGCGTTACGAATCCCTGTCGAGG
GAGCACAGCAATTTGCAAGAGGCCGCTCGAGAGCTGGCTGATTGCGACCCGGGCGAGCTGACGTCTGCTCGGCAA
GAGCTGAGAAACCTGGACGCAGACATCGCTCGGAAGAAGCAACGGATCGCTGAGCTTCGAGGGCGATTTGAGAAC
TCGTCGACAGAGGTGGAGGAGCTTAGCCAGAGAAAGGCGAAGTGCATGGAAGAAATCGAGTCGTGTGAAAGAGTC
CGAGAGCAGTACCGTGGCTGGACAAGCCGAGAGGTCAACGGACTGAAAGCTCGGGTCGAGACCATCGAGAAGGAG
CACGGATGGGCAGTCACAGGGCTCTCCGGGACGAGCCTTTCGATGAGCTACAGGCGGGAAATTGAACTCGTGTTC
GATATCGTCTCCTTCCAGCACGATGGCTCGTCATCTTCCCTGGACCTCTGGTACATCGCCGATAAACGAGAGAAG
CAGGCGATTCCGAAGACGACGGAACACGAGTTCTTCCTCCAGTGCATTCGCGACCACGTTCGGACGTTGTCGCAG
AGCGGGCGGGGCAGGACAAAAATATCCGAGCTCCTTGGCATAATTCGGGCCGGGTGGGACAAGGCCCGGCTGGTG
TCATCTGCAATCAGCCGCATCAACATCGTCTTCCCCACTAGGGTGGAGAAAAAGTCCGATACAAGCATCAGCGTG
ACGAGCTCGGTGCTGCTGGTGCCCCTGCAAACCAAGGTCGAAGTCACTTTGGTACTACGAGGCTGCAGCGGCCCG
TCTGGGGTAGACGTGGGGATATCTGTGGAGGCAAACGTTGTGTATGGGGAGCACTTTAACGTGGCCAAGATTGGC
GAGTTCCTGACGACGAGGATTGGCGGGCGGGTTGGCGAGGGGAGCGAGGATTGGAGCGAGGTGATGATGGAGCTG
CAGCGGAAGCTGATTGCCACTGGCAGGAAGTGA
Gene >Hirsu2|7854
ATGATCAACAGTCTGAGCCCGAAATGGAAACCTTTGAGAGGCAGGAAGAGTCTCCATGTCGGAAGCGCCAAAGGC
TTGCTGGGCAAGCGACCTTCCGAGCTCGATGAGGACGAGGAAGCTGAAGATGACGACGGAGTGAAGAGGCTTAAG
GGGCATCAGGGCAGCCCGGTCAAGAATGTTCGACTGCAACAGCCGCCGTCGAAGTCCGAGACTGTTGGGCGACTC
ACGAGATCAGGGCGAAAGAGCCTCGAGCACGGCAACGGTGTTTCGACGCCCTCGCTTTCGTCTCCCGTCAAGCAA
GCAGCCACTACGCCACAGAACCAGGGGCGTTTCAAGGATGTCGGAGGCAGCAAGACTATACACGAAATCAATTTC
CAGGACTCGTGCGTCGTCAAGAATGAGGCCGAGCTTGAGAATGATATTGAAGAGGAGAAGATCCACCTTCAAGAT
TTCTTGAACATGATCTCAATTCGCTTCATGGAACTGACGACGACGAAGCGCCGCCATACGATTGCTCCAGGTAAT
GGCCAGGACGGCACTGTGGCTGACGGGCAAGACGATCTTTCGCTGGAGCGCTGTGTCGTTGCGGGTGCTTGTACT
GTTCCCATGCTTGAGCTGTACCAGCACTCATGCAGGGAGCTCAAAAAGTACATTTCCGAAGGCCGGCGAATGGTG
AAAGAGATCGAGAACGAGACATTTGAGGAGAACCCACCGCTCTTCCGCGAGTACATGTCAGCCTCACCGGACGTC
AAGGCACTCATGGACAACCAATTCAAAAACGTCAAGACACATGCTCGGCTCTTGAGCAAAGCAATGTGGTACGAG
TGGCGAATGAAGTTGCAGGATGGTCTCAAGGAAGGACTCGTGAGCCTGGCTGAGGGGATGGACAGAGACGACAGG
GTCCTTCAAGAGCAGCAGGACGCGTTGACATTGGTCTTGCCGGCCGTAGTGGCGCGTTACGAATCCCTGTCGAGG
GAGCACAGCAATTTGCAAGAGGCCGCTCGAGAGCTGGCTGATTGCGACCCGGGCGAGCTGACGTCTGCTCGGCAA
GAGCTGAGAAACCTGGACGCAGACATCGCTCGGAAGAAGCAACGGATCGCTGAGCTTCGAGGGCGATTTGAGAAC
TCGTCGACAGAGGTGGAGGAGCTTAGCCAGAGAAAGGCGAAGTGCATGGAAGAAATCGAGTCGTGTGAAAGAGTC
CGAGAGCAGTACCGTGGCTGGACAAGCCGAGAGGTCAACGGACTGAAAGGTAGGCTGCCGACCAGGCGTGTTGAC
GGCGAATGCCTGCTGACGGTTGGTAAAGCTCGGGTCGAGACCATCGAGAAGGAGCACGGATGGGCAGTCACAGGG
CTCTCCGGGACGAGCCTTTCGATGAGCTACAGGCGGGAAATTGAACTCGTGTTCGATATCGTCTCCTTCCAGCAC
GATGGCTCGTCATCTTCCCTGGACCTCTGGTACATCGCCGATAAACGAGAGAAGCAGGCGATTCCGAAGACGACG
GAACACGAGTTCTTCCTCCAGTGCATTCGCGACCACGTTCGGACGTTGTCGCAGAGCGGGCGGGGCAGGACAAAA
ATATCCGAGCTCCTTGGCATAATTCGGGCCGGGTGGGACAAGGCCCGGCTGGTGTCATCTGCAATCAGCCGCATC
AACATCGTCTTCCCCACTAGGGTGGAGAAAAAGTCCGATACAAGCATCAGCGTGACGAGCTCGGTGCTGCTGGTG
CCCCTGCAAACCAAGGTCGAAGTCACTTTGGTACTACGAGGCTGCAGCGGCCCGTCTGGGGTAGACGTGGGGATA
TCTGTGGAGGCAAACGTTGTGTATGGGGAGCACTTTAACGTGGCCAAGATTGGCGAGTTCCTGACGACGAGGATT
GGCGGGCGGGTTGGCGAGGGGAGCGAGGATTGGAGCGAGGTGATGATGGAGCTGCAGCGGAAGCTGATTGCCACT
GGCAGGAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail