Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7851
Gene name
LocationContig_48:47000..50705
Strand+
Gene length (bp)3705
Transcript length (bp)3705
Coding sequence length (bp)3705
Protein length (aa) 1235

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12768 Rax2 Cortical protein marker for cell polarity 2.3E-71 1008 1217

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14239|RAX2_SCHPO Polarized growth protein rax2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rax2 PE=1 SV=1 54 1192 9.0E-58
sp|Q12465|RAX2_YEAST Bud site selection protein RAX2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAX2 PE=1 SV=1 154 561 5.0E-39

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 1163 1185 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7851
MRLPLGQRRSAPLPEVLGSCSLLALAALAPSLSRAINFPAVPSADLDLSNLGRINVAGDFNGISLVDYEAQIAKL
RTTNGSHSILARLPNGALAPIVATDASIRSMCTLRRRNGDLEGVIIGGNFTSLDSTESTAIALFNPNSNEVKSLN
GLEGEVRAVFCDQDRETVYVGGRFRGANSTNALAWSSDKGWINLPFAGFNGPVEAITKSPNGHIVFGGNFTGLGN
ASAPSRPDVQTINLSTANITATNTASTDGFSDPNSIVCADGAGGAGHTWLLQDQTPGTWGASFGFGFEPTKLRLW
NARQDGRGTKTFRFLAFPINGIMNLTYVDPTTGQNTTCTSECPLSNDPKAEYQDFHFVNQVGMNSFQIAISDWHG
QGAGLAGIRLFQDDIFAYAIPDFNEPTCGGTQFPSSASSTGPWKHSPSVQSNADYLMAEFSSPIKSNAASVVFFP
SIRESGNYSVNMYTPGCKPDRTCDTRGRVNVTGTLAPGVSAEFSNTLFQTNNFDKYDQIYFGYVEKTSDSFKPSV
TLTPLAGQDVDKLTVVAQRVGFTLTNSTGGLNGLFDFDPDNPTVDVSKFEKSPINKLGSGFSRNSGVTTLSTVGD
VVYIGGDFRSEKQAANVVAIGGAKDDDVQSLDGGLDGRVLAMYAQDAKLYVGGDFTNKKSSPQEGLDHVAVFDTR
ANSWATLGNGVNGRVQHVVPLVVNISQDATETAVTLSGAFTECKAFGDNKAIPVDGFAVWVPSKGNWLQNLDGSH
PAYSGVLTGAALDLPNNDKLFAGSVASAQLGANGIATLSDKGLGSTAKLQASPPPSRNGGRDGLADEMPRGVVTG
TFYDNGDSNVTVLAGHFTAQTDKGSTVSNLAFVDGSQRGSISGLAPGVSAESTFNTLAVRGSVLYAGGKVSGTVS
DRPIRGLVAYDMKAKAYSNQPAPVAGKRGTVSAISVRPDTAEVYVAGSFDKAGALDCPGVCLYNADSDQWVQPGN
GLGGEVSCLMWSSDSTLIAGGDMRGNGSDTLYLASFNAKRQEWMSFPGAEGIPGPVQVMTPGSSDGNQVWVAGTS
AKDGSTFVMKFDGSGWKRAQPALAAKTVLRSLQVFSLTRGHGKTDILDDKQALMLTGSIELPDVGVVSAAIYNGT
HYRPYALTTHSGGGGGSIAKIFTQKDDFFSSSGGGMPLVFVVLIGLAISLGLVLLLVLAGMVLDRLRKKREGYTP
APTSMYDRGSGIQRIPPRELLESLGKSRPAAPHV*
Coding >Hirsu2|7851
ATGCGGCTGCCCCTTGGACAGCGTCGCTCGGCGCCGCTGCCAGAGGTCCTGGGCTCCTGCTCGCTGCTGGCCCTG
GCAGCCCTGGCGCCGTCCTTGTCCCGAGCCATCAACTTTCCAGCCGTTCCCTCCGCCGACCTCGACCTCTCCAAC
CTGGGGAGGATAAACGTTGCTGGCGATTTCAATGGCATCTCCCTCGTCGACTACGAGGCGCAGATCGCCAAACTC
CGGACCACCAACGGCAGCCACTCCATCCTCGCCCGACTTCCCAACGGCGCGCTTGCCCCCATCGTCGCCACGGAC
GCTTCGATTCGATCCATGTGCACGCTGCGGCGCAGAAACGGCGACCTCGAGGGCGTCATCATCGGCGGCAACTTC
ACCAGTCTCGACAGCACCGAATCCACCGCCATTGCCCTCTTCAACCCCAATTCCAACGAGGTCAAGTCGCTCAAC
GGCCTCGAGGGCGAGGTTCGTGCCGTCTTCTGCGATCAGGACCGCGAAACCGTCTACGTCGGCGGCCGCTTCCGC
GGTGCCAACTCCACAAACGCCCTCGCCTGGTCCAGCGACAAGGGCTGGATCAACCTGCCCTTTGCCGGCTTCAAT
GGCCCCGTCGAGGCAATCACCAAGTCGCCCAACGGCCACATCGTCTTTGGCGGCAACTTCACCGGCCTCGGCAAC
GCCAGCGCCCCCAGCCGGCCCGACGTGCAGACCATCAACCTGTCGACCGCCAACATCACGGCCACCAACACGGCC
TCGACCGATGGCTTCTCCGACCCCAACAGCATCGTCTGCGCCGACGGAGCCGGCGGCGCCGGACACACGTGGCTG
CTGCAGGACCAAACGCCGGGCACCTGGGGCGCCAGCTTCGGCTTCGGCTTCGAGCCCACCAAGCTGCGGCTCTGG
AACGCGCGCCAGGACGGCCGCGGGACCAAGACGTTCCGCTTCCTCGCCTTCCCCATCAACGGCATCATGAACTTG
ACCTACGTCGATCCCACCACCGGCCAGAACACCACGTGCACCAGCGAATGCCCCCTGAGCAACGACCCCAAGGCC
GAGTATCAGGACTTCCACTTTGTGAACCAGGTCGGCATGAACAGCTTCCAGATCGCCATATCCGACTGGCACGGC
CAAGGCGCCGGCCTGGCCGGCATCAGGCTCTTCCAGGACGACATCTTCGCCTACGCCATCCCCGACTTTAACGAG
CCGACCTGCGGCGGGACCCAGTTCCCCTCGAGCGCCTCGTCCACCGGCCCGTGGAAGCACTCGCCCTCGGTGCAG
AGCAACGCCGACTATCTGATGGCCGAATTTTCAAGCCCCATCAAGTCCAACGCCGCCTCCGTCGTCTTCTTTCCG
AGCATCCGCGAGTCGGGCAACTACTCCGTCAACATGTACACGCCGGGCTGCAAGCCGGACCGCACCTGCGACACG
CGCGGCCGCGTCAACGTGACGGGCACCTTGGCGCCCGGCGTCAGCGCCGAATTCTCCAACACGCTGTTCCAGACG
AACAACTTCGACAAGTACGACCAGATCTACTTCGGCTACGTGGAGAAGACGTCGGACAGCTTCAAGCCTAGCGTG
ACCTTGACTCCGCTCGCCGGTCAGGACGTCGACAAGCTGACCGTCGTCGCCCAGAGAGTGGGCTTCACCCTCACC
AACTCAACCGGCGGGCTCAACGGGCTCTTCGACTTCGATCCGGACAACCCGACCGTCGACGTGTCGAAATTCGAA
AAATCGCCCATCAACAAGCTCGGCTCCGGCTTCAGTCGCAACTCGGGCGTCACGACGCTGTCGACGGTGGGCGAC
GTCGTCTACATCGGTGGCGACTTCAGGTCGGAGAAGCAGGCGGCCAACGTCGTGGCCATCGGCGGGGCCAAGGAC
GACGACGTGCAGTCCCTCGACGGAGGCCTCGACGGCCGGGTTCTGGCCATGTATGCCCAGGACGCCAAGCTCTAC
GTCGGCGGCGACTTCACCAACAAAAAGTCGAGCCCGCAAGAGGGACTGGACCACGTGGCCGTCTTCGACACGCGA
GCCAACTCGTGGGCTACTCTGGGCAACGGAGTCAACGGACGGGTGCAGCACGTCGTGCCCCTGGTGGTCAACATT
TCCCAGGACGCCACCGAGACGGCCGTGACCTTGTCCGGGGCCTTCACCGAGTGCAAGGCGTTCGGCGACAACAAG
GCAATCCCCGTCGACGGCTTCGCCGTCTGGGTCCCGTCCAAGGGCAACTGGCTGCAGAACCTCGACGGCTCCCAC
CCCGCCTACAGCGGCGTCCTGACCGGCGCGGCCCTGGACCTGCCCAACAACGACAAGCTCTTTGCCGGTTCGGTC
GCGTCGGCGCAGCTCGGCGCGAACGGCATCGCCACTCTCAGCGACAAGGGCCTCGGCAGTACCGCCAAGCTGCAA
GCCTCGCCGCCGCCGTCGCGGAACGGCGGACGCGACGGGCTCGCGGACGAGATGCCGCGCGGCGTGGTCACGGGC
ACCTTCTACGACAACGGCGACAGCAACGTGACGGTGCTGGCCGGGCACTTCACGGCCCAGACGGACAAGGGGTCG
ACGGTCAGCAACCTGGCCTTCGTCGACGGGAGCCAGCGCGGCTCGATCAGCGGGCTGGCACCCGGCGTATCGGCG
GAATCGACCTTTAACACCCTGGCCGTGCGCGGCAGCGTGCTCTACGCCGGCGGCAAGGTCAGCGGCACGGTGTCG
GACAGGCCGATCCGGGGCCTGGTCGCCTACGACATGAAGGCCAAGGCCTACAGCAACCAGCCGGCGCCCGTGGCC
GGGAAGAGGGGCACCGTGTCGGCCATCAGCGTGCGGCCGGACACGGCCGAGGTCTACGTGGCCGGGTCCTTCGAC
AAGGCCGGCGCGCTCGACTGCCCGGGCGTCTGCCTGTACAACGCGGACTCGGACCAGTGGGTCCAGCCGGGAAAC
GGGCTGGGGGGCGAGGTGTCTTGCCTCATGTGGTCGAGCGACTCGACGCTCATCGCCGGCGGCGACATGCGCGGC
AACGGCTCCGACACGCTCTACCTGGCGTCGTTTAACGCGAAGCGGCAGGAGTGGATGAGCTTCCCCGGGGCCGAA
GGCATACCGGGCCCGGTCCAGGTGATGACGCCCGGGTCGAGCGACGGCAACCAGGTGTGGGTGGCGGGCACGTCG
GCCAAGGACGGGTCGACGTTCGTCATGAAGTTCGACGGCAGCGGGTGGAAGCGTGCGCAGCCGGCGCTGGCGGCC
AAGACGGTGCTGCGGAGCCTGCAGGTGTTCAGCCTGACGCGGGGCCACGGCAAGACGGACATCTTGGACGACAAG
CAGGCACTGATGCTGACGGGCTCGATCGAGCTGCCCGACGTCGGGGTCGTCTCGGCGGCCATCTACAACGGCACG
CACTACCGGCCGTATGCGCTGACGACGCACTCGGGCGGCGGCGGCGGCAGCATCGCCAAGATCTTCACGCAGAAG
GACGACTTCTTCTCGTCGAGCGGCGGCGGCATGCCGCTCGTGTTCGTGGTGCTGATCGGGCTGGCGATATCGCTG
GGGCTCGTGCTGCTGCTGGTGCTGGCGGGCATGGTGCTGGACCGGCTGCGGAAGAAGCGCGAGGGATACACGCCG
GCGCCGACGTCCATGTACGACCGAGGGAGCGGCATCCAGCGGATACCGCCGCGCGAACTGCTCGAATCGCTGGGC
AAGAGCCGGCCGGCGGCGCCGCACGTGTGA
Transcript >Hirsu2|7851
ATGCGGCTGCCCCTTGGACAGCGTCGCTCGGCGCCGCTGCCAGAGGTCCTGGGCTCCTGCTCGCTGCTGGCCCTG
GCAGCCCTGGCGCCGTCCTTGTCCCGAGCCATCAACTTTCCAGCCGTTCCCTCCGCCGACCTCGACCTCTCCAAC
CTGGGGAGGATAAACGTTGCTGGCGATTTCAATGGCATCTCCCTCGTCGACTACGAGGCGCAGATCGCCAAACTC
CGGACCACCAACGGCAGCCACTCCATCCTCGCCCGACTTCCCAACGGCGCGCTTGCCCCCATCGTCGCCACGGAC
GCTTCGATTCGATCCATGTGCACGCTGCGGCGCAGAAACGGCGACCTCGAGGGCGTCATCATCGGCGGCAACTTC
ACCAGTCTCGACAGCACCGAATCCACCGCCATTGCCCTCTTCAACCCCAATTCCAACGAGGTCAAGTCGCTCAAC
GGCCTCGAGGGCGAGGTTCGTGCCGTCTTCTGCGATCAGGACCGCGAAACCGTCTACGTCGGCGGCCGCTTCCGC
GGTGCCAACTCCACAAACGCCCTCGCCTGGTCCAGCGACAAGGGCTGGATCAACCTGCCCTTTGCCGGCTTCAAT
GGCCCCGTCGAGGCAATCACCAAGTCGCCCAACGGCCACATCGTCTTTGGCGGCAACTTCACCGGCCTCGGCAAC
GCCAGCGCCCCCAGCCGGCCCGACGTGCAGACCATCAACCTGTCGACCGCCAACATCACGGCCACCAACACGGCC
TCGACCGATGGCTTCTCCGACCCCAACAGCATCGTCTGCGCCGACGGAGCCGGCGGCGCCGGACACACGTGGCTG
CTGCAGGACCAAACGCCGGGCACCTGGGGCGCCAGCTTCGGCTTCGGCTTCGAGCCCACCAAGCTGCGGCTCTGG
AACGCGCGCCAGGACGGCCGCGGGACCAAGACGTTCCGCTTCCTCGCCTTCCCCATCAACGGCATCATGAACTTG
ACCTACGTCGATCCCACCACCGGCCAGAACACCACGTGCACCAGCGAATGCCCCCTGAGCAACGACCCCAAGGCC
GAGTATCAGGACTTCCACTTTGTGAACCAGGTCGGCATGAACAGCTTCCAGATCGCCATATCCGACTGGCACGGC
CAAGGCGCCGGCCTGGCCGGCATCAGGCTCTTCCAGGACGACATCTTCGCCTACGCCATCCCCGACTTTAACGAG
CCGACCTGCGGCGGGACCCAGTTCCCCTCGAGCGCCTCGTCCACCGGCCCGTGGAAGCACTCGCCCTCGGTGCAG
AGCAACGCCGACTATCTGATGGCCGAATTTTCAAGCCCCATCAAGTCCAACGCCGCCTCCGTCGTCTTCTTTCCG
AGCATCCGCGAGTCGGGCAACTACTCCGTCAACATGTACACGCCGGGCTGCAAGCCGGACCGCACCTGCGACACG
CGCGGCCGCGTCAACGTGACGGGCACCTTGGCGCCCGGCGTCAGCGCCGAATTCTCCAACACGCTGTTCCAGACG
AACAACTTCGACAAGTACGACCAGATCTACTTCGGCTACGTGGAGAAGACGTCGGACAGCTTCAAGCCTAGCGTG
ACCTTGACTCCGCTCGCCGGTCAGGACGTCGACAAGCTGACCGTCGTCGCCCAGAGAGTGGGCTTCACCCTCACC
AACTCAACCGGCGGGCTCAACGGGCTCTTCGACTTCGATCCGGACAACCCGACCGTCGACGTGTCGAAATTCGAA
AAATCGCCCATCAACAAGCTCGGCTCCGGCTTCAGTCGCAACTCGGGCGTCACGACGCTGTCGACGGTGGGCGAC
GTCGTCTACATCGGTGGCGACTTCAGGTCGGAGAAGCAGGCGGCCAACGTCGTGGCCATCGGCGGGGCCAAGGAC
GACGACGTGCAGTCCCTCGACGGAGGCCTCGACGGCCGGGTTCTGGCCATGTATGCCCAGGACGCCAAGCTCTAC
GTCGGCGGCGACTTCACCAACAAAAAGTCGAGCCCGCAAGAGGGACTGGACCACGTGGCCGTCTTCGACACGCGA
GCCAACTCGTGGGCTACTCTGGGCAACGGAGTCAACGGACGGGTGCAGCACGTCGTGCCCCTGGTGGTCAACATT
TCCCAGGACGCCACCGAGACGGCCGTGACCTTGTCCGGGGCCTTCACCGAGTGCAAGGCGTTCGGCGACAACAAG
GCAATCCCCGTCGACGGCTTCGCCGTCTGGGTCCCGTCCAAGGGCAACTGGCTGCAGAACCTCGACGGCTCCCAC
CCCGCCTACAGCGGCGTCCTGACCGGCGCGGCCCTGGACCTGCCCAACAACGACAAGCTCTTTGCCGGTTCGGTC
GCGTCGGCGCAGCTCGGCGCGAACGGCATCGCCACTCTCAGCGACAAGGGCCTCGGCAGTACCGCCAAGCTGCAA
GCCTCGCCGCCGCCGTCGCGGAACGGCGGACGCGACGGGCTCGCGGACGAGATGCCGCGCGGCGTGGTCACGGGC
ACCTTCTACGACAACGGCGACAGCAACGTGACGGTGCTGGCCGGGCACTTCACGGCCCAGACGGACAAGGGGTCG
ACGGTCAGCAACCTGGCCTTCGTCGACGGGAGCCAGCGCGGCTCGATCAGCGGGCTGGCACCCGGCGTATCGGCG
GAATCGACCTTTAACACCCTGGCCGTGCGCGGCAGCGTGCTCTACGCCGGCGGCAAGGTCAGCGGCACGGTGTCG
GACAGGCCGATCCGGGGCCTGGTCGCCTACGACATGAAGGCCAAGGCCTACAGCAACCAGCCGGCGCCCGTGGCC
GGGAAGAGGGGCACCGTGTCGGCCATCAGCGTGCGGCCGGACACGGCCGAGGTCTACGTGGCCGGGTCCTTCGAC
AAGGCCGGCGCGCTCGACTGCCCGGGCGTCTGCCTGTACAACGCGGACTCGGACCAGTGGGTCCAGCCGGGAAAC
GGGCTGGGGGGCGAGGTGTCTTGCCTCATGTGGTCGAGCGACTCGACGCTCATCGCCGGCGGCGACATGCGCGGC
AACGGCTCCGACACGCTCTACCTGGCGTCGTTTAACGCGAAGCGGCAGGAGTGGATGAGCTTCCCCGGGGCCGAA
GGCATACCGGGCCCGGTCCAGGTGATGACGCCCGGGTCGAGCGACGGCAACCAGGTGTGGGTGGCGGGCACGTCG
GCCAAGGACGGGTCGACGTTCGTCATGAAGTTCGACGGCAGCGGGTGGAAGCGTGCGCAGCCGGCGCTGGCGGCC
AAGACGGTGCTGCGGAGCCTGCAGGTGTTCAGCCTGACGCGGGGCCACGGCAAGACGGACATCTTGGACGACAAG
CAGGCACTGATGCTGACGGGCTCGATCGAGCTGCCCGACGTCGGGGTCGTCTCGGCGGCCATCTACAACGGCACG
CACTACCGGCCGTATGCGCTGACGACGCACTCGGGCGGCGGCGGCGGCAGCATCGCCAAGATCTTCACGCAGAAG
GACGACTTCTTCTCGTCGAGCGGCGGCGGCATGCCGCTCGTGTTCGTGGTGCTGATCGGGCTGGCGATATCGCTG
GGGCTCGTGCTGCTGCTGGTGCTGGCGGGCATGGTGCTGGACCGGCTGCGGAAGAAGCGCGAGGGATACACGCCG
GCGCCGACGTCCATGTACGACCGAGGGAGCGGCATCCAGCGGATACCGCCGCGCGAACTGCTCGAATCGCTGGGC
AAGAGCCGGCCGGCGGCGCCGCACGTGTGA
Gene >Hirsu2|7851
ATGCGGCTGCCCCTTGGACAGCGTCGCTCGGCGCCGCTGCCAGAGGTCCTGGGCTCCTGCTCGCTGCTGGCCCTG
GCAGCCCTGGCGCCGTCCTTGTCCCGAGCCATCAACTTTCCAGCCGTTCCCTCCGCCGACCTCGACCTCTCCAAC
CTGGGGAGGATAAACGTTGCTGGCGATTTCAATGGCATCTCCCTCGTCGACTACGAGGCGCAGATCGCCAAACTC
CGGACCACCAACGGCAGCCACTCCATCCTCGCCCGACTTCCCAACGGCGCGCTTGCCCCCATCGTCGCCACGGAC
GCTTCGATTCGATCCATGTGCACGCTGCGGCGCAGAAACGGCGACCTCGAGGGCGTCATCATCGGCGGCAACTTC
ACCAGTCTCGACAGCACCGAATCCACCGCCATTGCCCTCTTCAACCCCAATTCCAACGAGGTCAAGTCGCTCAAC
GGCCTCGAGGGCGAGGTTCGTGCCGTCTTCTGCGATCAGGACCGCGAAACCGTCTACGTCGGCGGCCGCTTCCGC
GGTGCCAACTCCACAAACGCCCTCGCCTGGTCCAGCGACAAGGGCTGGATCAACCTGCCCTTTGCCGGCTTCAAT
GGCCCCGTCGAGGCAATCACCAAGTCGCCCAACGGCCACATCGTCTTTGGCGGCAACTTCACCGGCCTCGGCAAC
GCCAGCGCCCCCAGCCGGCCCGACGTGCAGACCATCAACCTGTCGACCGCCAACATCACGGCCACCAACACGGCC
TCGACCGATGGCTTCTCCGACCCCAACAGCATCGTCTGCGCCGACGGAGCCGGCGGCGCCGGACACACGTGGCTG
CTGCAGGACCAAACGCCGGGCACCTGGGGCGCCAGCTTCGGCTTCGGCTTCGAGCCCACCAAGCTGCGGCTCTGG
AACGCGCGCCAGGACGGCCGCGGGACCAAGACGTTCCGCTTCCTCGCCTTCCCCATCAACGGCATCATGAACTTG
ACCTACGTCGATCCCACCACCGGCCAGAACACCACGTGCACCAGCGAATGCCCCCTGAGCAACGACCCCAAGGCC
GAGTATCAGGACTTCCACTTTGTGAACCAGGTCGGCATGAACAGCTTCCAGATCGCCATATCCGACTGGCACGGC
CAAGGCGCCGGCCTGGCCGGCATCAGGCTCTTCCAGGACGACATCTTCGCCTACGCCATCCCCGACTTTAACGAG
CCGACCTGCGGCGGGACCCAGTTCCCCTCGAGCGCCTCGTCCACCGGCCCGTGGAAGCACTCGCCCTCGGTGCAG
AGCAACGCCGACTATCTGATGGCCGAATTTTCAAGCCCCATCAAGTCCAACGCCGCCTCCGTCGTCTTCTTTCCG
AGCATCCGCGAGTCGGGCAACTACTCCGTCAACATGTACACGCCGGGCTGCAAGCCGGACCGCACCTGCGACACG
CGCGGCCGCGTCAACGTGACGGGCACCTTGGCGCCCGGCGTCAGCGCCGAATTCTCCAACACGCTGTTCCAGACG
AACAACTTCGACAAGTACGACCAGATCTACTTCGGCTACGTGGAGAAGACGTCGGACAGCTTCAAGCCTAGCGTG
ACCTTGACTCCGCTCGCCGGTCAGGACGTCGACAAGCTGACCGTCGTCGCCCAGAGAGTGGGCTTCACCCTCACC
AACTCAACCGGCGGGCTCAACGGGCTCTTCGACTTCGATCCGGACAACCCGACCGTCGACGTGTCGAAATTCGAA
AAATCGCCCATCAACAAGCTCGGCTCCGGCTTCAGTCGCAACTCGGGCGTCACGACGCTGTCGACGGTGGGCGAC
GTCGTCTACATCGGTGGCGACTTCAGGTCGGAGAAGCAGGCGGCCAACGTCGTGGCCATCGGCGGGGCCAAGGAC
GACGACGTGCAGTCCCTCGACGGAGGCCTCGACGGCCGGGTTCTGGCCATGTATGCCCAGGACGCCAAGCTCTAC
GTCGGCGGCGACTTCACCAACAAAAAGTCGAGCCCGCAAGAGGGACTGGACCACGTGGCCGTCTTCGACACGCGA
GCCAACTCGTGGGCTACTCTGGGCAACGGAGTCAACGGACGGGTGCAGCACGTCGTGCCCCTGGTGGTCAACATT
TCCCAGGACGCCACCGAGACGGCCGTGACCTTGTCCGGGGCCTTCACCGAGTGCAAGGCGTTCGGCGACAACAAG
GCAATCCCCGTCGACGGCTTCGCCGTCTGGGTCCCGTCCAAGGGCAACTGGCTGCAGAACCTCGACGGCTCCCAC
CCCGCCTACAGCGGCGTCCTGACCGGCGCGGCCCTGGACCTGCCCAACAACGACAAGCTCTTTGCCGGTTCGGTC
GCGTCGGCGCAGCTCGGCGCGAACGGCATCGCCACTCTCAGCGACAAGGGCCTCGGCAGTACCGCCAAGCTGCAA
GCCTCGCCGCCGCCGTCGCGGAACGGCGGACGCGACGGGCTCGCGGACGAGATGCCGCGCGGCGTGGTCACGGGC
ACCTTCTACGACAACGGCGACAGCAACGTGACGGTGCTGGCCGGGCACTTCACGGCCCAGACGGACAAGGGGTCG
ACGGTCAGCAACCTGGCCTTCGTCGACGGGAGCCAGCGCGGCTCGATCAGCGGGCTGGCACCCGGCGTATCGGCG
GAATCGACCTTTAACACCCTGGCCGTGCGCGGCAGCGTGCTCTACGCCGGCGGCAAGGTCAGCGGCACGGTGTCG
GACAGGCCGATCCGGGGCCTGGTCGCCTACGACATGAAGGCCAAGGCCTACAGCAACCAGCCGGCGCCCGTGGCC
GGGAAGAGGGGCACCGTGTCGGCCATCAGCGTGCGGCCGGACACGGCCGAGGTCTACGTGGCCGGGTCCTTCGAC
AAGGCCGGCGCGCTCGACTGCCCGGGCGTCTGCCTGTACAACGCGGACTCGGACCAGTGGGTCCAGCCGGGAAAC
GGGCTGGGGGGCGAGGTGTCTTGCCTCATGTGGTCGAGCGACTCGACGCTCATCGCCGGCGGCGACATGCGCGGC
AACGGCTCCGACACGCTCTACCTGGCGTCGTTTAACGCGAAGCGGCAGGAGTGGATGAGCTTCCCCGGGGCCGAA
GGCATACCGGGCCCGGTCCAGGTGATGACGCCCGGGTCGAGCGACGGCAACCAGGTGTGGGTGGCGGGCACGTCG
GCCAAGGACGGGTCGACGTTCGTCATGAAGTTCGACGGCAGCGGGTGGAAGCGTGCGCAGCCGGCGCTGGCGGCC
AAGACGGTGCTGCGGAGCCTGCAGGTGTTCAGCCTGACGCGGGGCCACGGCAAGACGGACATCTTGGACGACAAG
CAGGCACTGATGCTGACGGGCTCGATCGAGCTGCCCGACGTCGGGGTCGTCTCGGCGGCCATCTACAACGGCACG
CACTACCGGCCGTATGCGCTGACGACGCACTCGGGCGGCGGCGGCGGCAGCATCGCCAAGATCTTCACGCAGAAG
GACGACTTCTTCTCGTCGAGCGGCGGCGGCATGCCGCTCGTGTTCGTGGTGCTGATCGGGCTGGCGATATCGCTG
GGGCTCGTGCTGCTGCTGGTGCTGGCGGGCATGGTGCTGGACCGGCTGCGGAAGAAGCGCGAGGGATACACGCCG
GCGCCGACGTCCATGTACGACCGAGGGAGCGGCATCCAGCGGATACCGCCGCGCGAACTGCTCGAATCGCTGGGC
AAGAGCCGGCCGGCGGCGCCGCACGTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail