Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|785
Gene name
LocationContig_1162:6604..8120
Strand+
Gene length (bp)1516
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00627 UBA UBA/TS-N domain 6.1E-05 287 321

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13773|UCP7_SCHPO UBA domain-containing protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp7 PE=3 SV=1 290 402 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|785
MDDLSGLDWSNPDGGRPKPPPPMNPPSFPSMRPTPSPLASGRSTPLSSQASTGPPPKTAAAKPSHDSFSNLVHFG
SAKAGQHLTLAERQAQLEAEKRKRDEERRRQAESQFGTGQQWDALGSRTFTPSPALKAPDDDDDLFAAFNKDTKV
DNASHYPPPDSDRSTPANGTRLNLSDPSAWNSTAGLDSGPPLAADDDDPFGLNELKPTAGPPAPAPAGGHDDDDD
FLGDLGKPIEEVRKMRQDASRPAPGKPIEIDDSSSSSDDEPQPRRQAPDRKAGGDADAFDRALAQLVDYGFSPDD
ARRGLMQSGSGNNVQAAANWLLDDAHRKAKQNSRESGSAAAHEVDPRTGAARGDVDFTKSAAAMGNSLFKTANSL
WKTGQKKMQQAVADFQQEGDPSQPKWMRDSQSGRAQGRSGGPGAAHATDEALALDSSSSSNSRHAGSRLRCRPTR
GQDSTD*
Coding >Hirsu2|785
ATGGACGACCTCTCGGGCCTCGATTGGTCCAACCCGGACGGCGGCCGCCCCAAGCCACCGCCTCCCATGAACCCC
CCTTCCTTTCCCTCCATGCGCCCGACGCCCTCGCCCCTGGCCTCCGGCCGCAGCACGCCCCTGTCCTCCCAGGCC
TCGACCGGGCCGCCGCCCAAGACGGCCGCCGCAAAGCCGTCGCACGATAGCTTCAGCAACCTCGTCCACTTTGGC
TCGGCAAAGGCCGGCCAGCACCTGACGCTGGCCGAGCGGCAGGCCCAGCTCGAGGCCGAGAAGCGCAAGAGGGAC
GAGGAGCGCAGGAGGCAGGCCGAGTCGCAGTTCGGCACCGGCCAGCAGTGGGACGCCCTGGGCTCGCGCACATTC
ACCCCGAGCCCCGCCCTCAAGGCCCCGGACGACGACGACGACCTGTTCGCCGCCTTCAACAAGGACACCAAGGTC
GACAATGCGAGCCACTACCCTCCGCCCGACTCGGACCGCTCCACGCCCGCCAACGGCACGCGCCTCAACCTCAGC
GACCCGAGCGCATGGAATTCGACGGCCGGCCTCGACAGCGGCCCGCCCTTGGCAGCCGACGACGACGACCCCTTC
GGCCTGAACGAGCTGAAGCCCACCGCGGGGCCCCCTGCTCCCGCGCCGGCCGGTGGCCACGACGACGACGACGAC
TTTCTGGGAGACCTGGGCAAGCCAATAGAAGAGGTGCGGAAAATGCGGCAGGACGCGTCACGCCCCGCGCCCGGG
AAGCCCATCGAGATTGACGATTCCAGCTCGTCGTCCGACGACGAACCCCAGCCACGGCGACAAGCTCCGGACCGG
AAAGCCGGCGGCGACGCGGATGCTTTTGACAGGGCCCTCGCCCAGCTCGTCGACTACGGCTTCTCCCCGGACGAT
GCCCGGAGAGGCCTGATGCAGAGCGGCAGCGGAAACAACGTCCAGGCCGCGGCCAACTGGCTCCTGGACGACGCC
CACAGGAAGGCGAAGCAGAATTCGCGCGAGAGCGGCTCCGCCGCCGCCCACGAGGTCGACCCGAGGACGGGTGCC
GCCAGAGGGGACGTCGACTTCACCAAATCCGCCGCCGCCATGGGCAACAGCCTGTTCAAGACGGCCAACTCGCTG
TGGAAGACGGGACAGAAGAAGATGCAGCAGGCAGTGGCCGATTTCCAGCAAGAGGGCGACCCCAGCCAGCCAAAG
TGGATGCGCGATTCGCAGTCGGGGCGCGCGCAAGGGCGATCGGGAGGACCTGGCGCGGCGCACGCCACCGACGAG
GCTCTCGCGCTCGACAGCAGCAGCAGCAGCAACAGCCGCCACGCCGGTTCACGCCTCCGGTGCCGTCCGACGCGC
GGTCAAGACTCAACAGACTAG
Transcript >Hirsu2|785
ATGGACGACCTCTCGGGCCTCGATTGGTCCAACCCGGACGGCGGCCGCCCCAAGCCACCGCCTCCCATGAACCCC
CCTTCCTTTCCCTCCATGCGCCCGACGCCCTCGCCCCTGGCCTCCGGCCGCAGCACGCCCCTGTCCTCCCAGGCC
TCGACCGGGCCGCCGCCCAAGACGGCCGCCGCAAAGCCGTCGCACGATAGCTTCAGCAACCTCGTCCACTTTGGC
TCGGCAAAGGCCGGCCAGCACCTGACGCTGGCCGAGCGGCAGGCCCAGCTCGAGGCCGAGAAGCGCAAGAGGGAC
GAGGAGCGCAGGAGGCAGGCCGAGTCGCAGTTCGGCACCGGCCAGCAGTGGGACGCCCTGGGCTCGCGCACATTC
ACCCCGAGCCCCGCCCTCAAGGCCCCGGACGACGACGACGACCTGTTCGCCGCCTTCAACAAGGACACCAAGGTC
GACAATGCGAGCCACTACCCTCCGCCCGACTCGGACCGCTCCACGCCCGCCAACGGCACGCGCCTCAACCTCAGC
GACCCGAGCGCATGGAATTCGACGGCCGGCCTCGACAGCGGCCCGCCCTTGGCAGCCGACGACGACGACCCCTTC
GGCCTGAACGAGCTGAAGCCCACCGCGGGGCCCCCTGCTCCCGCGCCGGCCGGTGGCCACGACGACGACGACGAC
TTTCTGGGAGACCTGGGCAAGCCAATAGAAGAGGTGCGGAAAATGCGGCAGGACGCGTCACGCCCCGCGCCCGGG
AAGCCCATCGAGATTGACGATTCCAGCTCGTCGTCCGACGACGAACCCCAGCCACGGCGACAAGCTCCGGACCGG
AAAGCCGGCGGCGACGCGGATGCTTTTGACAGGGCCCTCGCCCAGCTCGTCGACTACGGCTTCTCCCCGGACGAT
GCCCGGAGAGGCCTGATGCAGAGCGGCAGCGGAAACAACGTCCAGGCCGCGGCCAACTGGCTCCTGGACGACGCC
CACAGGAAGGCGAAGCAGAATTCGCGCGAGAGCGGCTCCGCCGCCGCCCACGAGGTCGACCCGAGGACGGGTGCC
GCCAGAGGGGACGTCGACTTCACCAAATCCGCCGCCGCCATGGGCAACAGCCTGTTCAAGACGGCCAACTCGCTG
TGGAAGACGGGACAGAAGAAGATGCAGCAGGCAGTGGCCGATTTCCAGCAAGAGGGCGACCCCAGCCAGCCAAAG
TGGATGCGCGATTCGCAGTCGGGGCGCGCGCAAGGGCGATCGGGAGGACCTGGCGCGGCGCACGCCACCGACGAG
GCTCTCGCGCTCGACAGCAGCAGCAGCAGCAACAGCCGCCACGCCGGTTCACGCCTCCGGTGCCGTCCGACGCGC
GGTCAAGACTCAACAGACTAG
Gene >Hirsu2|785
ATGGACGACCTCTCGGGCCTCGATTGGTCCAACCCGGACGGCGGCCGCCCCAAGCCACCGCCTCCCATGAACCCC
CCTTCCTTTCCCTCCATGCGCCCGACGCCCTCGCCCCTGGCCTCCGGCCGCAGCACGCCCCTGTCCTCCCAGGCC
TCGACCGGGCCGCCGCCCAAGACGGCCGCCGCAAAGCCGTCGCACGATAGCTTCAGCAACCTCGTCCACTTTGGC
TCGGCAAAGGCCGGCCAGCACCTGACGCTGGCCGAGCGGCAGGCCCAGCTCGAGGCCGAGAAGCGCAAGAGGGAC
GAGGAGCGCAGGAGGCAGGCCGAGTCGCAGTTCGGCACCGGCCAGCAGTGGGACGCCCTGGGCTCGCGCACATTC
ACCCCGAGCCCCGCCCTCAAGGCCCCGGACGACGACGACGACCTGTTCGCCGCCTTCAACAAGGACACCAAGGTC
GACAATGCGAGCCACTACCCTCCGCCCGACTCGGACCGCTCCACGCCCGCCAACGGCACGCGCCTCAACCTCAGC
GACCCGAGCGCATGGAATTCGACGGCCGGCCTCGACAGCGGCCCGCCCTTGGCAGCCGACGACGACGACCCCTTC
GGCCTGAACGAGCTGAAGCCCACCGCGGGGCCCCCTGCTCCCGCGCCGGCCGGTGGCCACGACGACGACGACGAC
TTTCTGGGAGACCTGGGCAAGCCAATAGAAGAGGTGCGGAAAATGCGGCAGGACGCGTCACGCCCCGCGCCCGGG
AAGCCCATCGAGATTGACGATTCCAGCTCGTCGTCCGACGACGAACCCCAGCCACGGCGACAAGCTCCGGACCGG
AAAGCCGGCGGCGACGCGGATGCTTTTGACAGGGCCCTCGCCCAGCTCGTCGACTACGGCTTCTCCCCGGACGAT
GCCCGGAGAGGCCTGATGCAGAGCGGCAGCGGAAACAACGTCCAGGCCGCGGCCAACTGGCTCCTGGACGACGCC
CACAGGAAGGCGAAGCAGAATTCGCGCGAGAGCGGCTCCGCCGCCGCCCACGAGGTCGACCCGAGGACGGGTGCC
GCCAGAGGGGACGTCGACTTCACCAAATCCGCCGCCGCCATGGGCAACAGCCTGTTCAAGACGGCCAACTCGCTG
TGGAAGACGGGACAGAAGAAGATGCAGCAGGCAGTGGCCGATTTCCAGCAAGAGGGCGACCCCAGCCAGCCAAAG
TGGATGCGCGATTCGCAGTCGGGGCGCGCGCAAGGGCGATCGGGAGGACCTGGCGCGGCGCACGCCACCGACGAG
GCTCTCGCGCTCGAGTCGGGCGGGAGGCCTGGACCTTCGCGAACCGACGGCCGACATGCCCCGGACCCTCGGGTT
TCGCCCAGGGCCTCTTCTCGTGCATCCTCGGCGGGCCCGTCGTCGGGCGCACCGAGCCGGAGCAGCTCGGCGCCG
CGTTGGCAGCAGCAGCAGCAGCAGCAACAGCCGCCACGCCGGTTCACGCCTCCGGTGCCGTCCGACGCGCGGTCA
AGACTCAACAGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail