Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7844
Gene name
LocationContig_48:28884..31362
Strand-
Gene length (bp)2478
Transcript length (bp)2478
Coding sequence length (bp)2478
Protein length (aa) 826

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.2E-56 43 310
PF07714 Pkinase_Tyr Protein tyrosine kinase 6.5E-43 44 306

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 42 368 6.0E-61
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 43 357 8.0E-58
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 43 338 1.0E-54
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 39 333 2.0E-50
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 47 326 3.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 42 368 6.0E-61
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 43 357 8.0E-58
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 43 338 1.0E-54
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 39 333 2.0E-50
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 47 326 3.0E-50
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 49 336 7.0E-49
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 49 336 8.0E-49
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 49 336 1.0E-48
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 47 369 4.0E-48
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 47 336 9.0E-48
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 43 373 3.0E-47
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 47 367 3.0E-47
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 47 335 1.0E-46
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 47 335 2.0E-46
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 43 310 8.0E-45
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 43 310 9.0E-45
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 43 310 4.0E-44
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 31 300 4.0E-44
sp|Q551H4|FRAY2_DICDI Serine/threonine-protein kinase fray2 OS=Dictyostelium discoideum GN=fray2 PE=3 SV=1 43 310 1.0E-43
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 43 330 5.0E-42
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 43 330 5.0E-42
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 43 330 7.0E-42
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 47 330 1.0E-41
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 15 330 7.0E-41
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 15 330 1.0E-40
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 15 330 1.0E-40
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 15 330 1.0E-40
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 15 330 1.0E-40
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 37 333 1.0E-40
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 15 330 2.0E-40
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 43 310 4.0E-40
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 43 310 5.0E-40
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 15 339 6.0E-40
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 43 310 6.0E-40
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 15 339 7.0E-40
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 15 339 8.0E-40
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 15 339 9.0E-40
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 43 310 1.0E-39
sp|Q54XL6|FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum GN=fray1 PE=3 SV=1 43 324 3.0E-39
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 43 310 4.0E-39
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 43 310 5.0E-39
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 43 310 6.0E-39
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 49 340 8.0E-39
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 43 323 1.0E-38
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 43 315 2.0E-38
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 43 315 2.0E-38
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 43 315 2.0E-38
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 43 315 3.0E-38
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 43 326 4.0E-38
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 43 335 4.0E-38
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 15 335 4.0E-38
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 43 335 7.0E-38
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 43 326 1.0E-37
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 43 310 2.0E-37
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 43 310 4.0E-37
sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 43 310 4.0E-37
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 43 326 4.0E-37
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 43 326 4.0E-37
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 43 326 5.0E-37
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 43 326 6.0E-37
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 43 312 8.0E-37
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 49 340 8.0E-37
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 43 326 9.0E-37
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 43 310 9.0E-37
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 43 310 1.0E-36
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 49 329 1.0E-36
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 14 325 1.0E-36
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 43 310 1.0E-36
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 43 310 2.0E-36
sp|Q7Z2Y5|NRK_HUMAN Nik-related protein kinase OS=Homo sapiens GN=NRK PE=1 SV=2 32 336 2.0E-36
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 23 338 2.0E-36
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 43 310 2.0E-36
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 49 313 2.0E-36
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 49 331 2.0E-36
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 35 316 3.0E-36
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 49 313 3.0E-36
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 43 335 3.0E-36
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 43 310 3.0E-36
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 43 310 3.0E-36
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 49 313 4.0E-36
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 43 310 4.0E-36
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 43 310 6.0E-36
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 43 326 6.0E-36
sp|Q9R0G8|NRK_MOUSE Nik-related protein kinase OS=Mus musculus GN=Nrk PE=1 SV=2 31 336 6.0E-36
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 43 315 7.0E-36
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 49 327 1.0E-35
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 43 315 1.0E-35
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 43 315 1.0E-35
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 15 335 1.0E-35
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 43 310 1.0E-35
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 49 327 3.0E-35
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 43 310 3.0E-35
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 49 310 3.0E-35
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 43 312 3.0E-35
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 49 313 3.0E-35
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 49 310 4.0E-35
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 43 310 5.0E-35
sp|O23304|BLUS1_ARATH Serine/threonine-protein kinase BLUS1 OS=Arabidopsis thaliana GN=BLUS1 PE=1 SV=1 43 310 5.0E-35
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 49 372 5.0E-35
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 41 310 9.0E-35
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 43 326 9.0E-35
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 43 326 1.0E-34
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 43 324 1.0E-34
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 49 310 2.0E-34
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 43 324 2.0E-34
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 43 324 3.0E-34
sp|P97820|M4K4_MOUSE Mitogen-activated protein kinase kinase kinase kinase 4 OS=Mus musculus GN=Map4k4 PE=1 SV=1 43 310 3.0E-34
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 49 310 3.0E-34
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 43 342 3.0E-34
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 49 334 3.0E-34
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 49 334 3.0E-34
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 49 334 3.0E-34
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 49 335 4.0E-34
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 41 310 4.0E-34
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 49 310 4.0E-34
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 43 327 5.0E-34
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 49 310 6.0E-34
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 23 327 1.0E-33
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 29 332 1.0E-33
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 43 327 1.0E-33
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 25 323 1.0E-33
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 49 330 2.0E-33
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 49 330 2.0E-33
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 43 321 2.0E-33
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 49 330 3.0E-33
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 43 314 3.0E-33
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 49 310 3.0E-33
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 49 310 4.0E-33
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 43 310 4.0E-33
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 49 310 4.0E-33
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 29 310 5.0E-33
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 43 310 6.0E-33
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 7 330 6.0E-33
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 49 323 8.0E-33
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 25 323 9.0E-33
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 43 310 1.0E-32
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 26 310 2.0E-32
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 41 310 2.0E-32
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 47 310 3.0E-32
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 41 310 3.0E-32
sp|G5EEN4|GCK3_CAEEL Germinal center kinase 3 OS=Caenorhabditis elegans GN=gck-3 PE=1 SV=1 39 315 3.0E-32
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 47 314 4.0E-32
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 43 310 4.0E-32
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 49 373 4.0E-32
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 34 310 6.0E-32
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 43 321 7.0E-32
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 43 310 8.0E-32
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 43 366 2.0E-31
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 49 330 2.0E-31
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 43 312 3.0E-31
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 30 310 4.0E-31
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 46 310 5.0E-31
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 43 310 5.0E-31
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 36 326 5.0E-31
sp|Q9I9E0|TAOK3_CHICK Serine/threonine-protein kinase TAO3 OS=Gallus gallus GN=TAOK3 PE=2 SV=2 49 310 6.0E-31
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 45 314 7.0E-31
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 43 330 8.0E-31
sp|O88664|TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus GN=Taok1 PE=1 SV=1 38 330 8.0E-31
sp|Q5F2E8|TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus GN=Taok1 PE=1 SV=1 38 330 9.0E-31
sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens GN=TAOK1 PE=1 SV=1 38 330 9.0E-31
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 43 314 1.0E-30
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 43 312 1.0E-30
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 43 322 1.0E-30
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 30 310 2.0E-30
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 43 310 2.0E-30
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 36 306 2.0E-30
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 42 330 2.0E-30
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 47 309 3.0E-30
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 43 311 5.0E-30
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 43 310 5.0E-30
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 26 323 6.0E-30
sp|Q9H2K8|TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens GN=TAOK3 PE=1 SV=2 49 310 6.0E-30
sp|Q8BYC6|TAOK3_MOUSE Serine/threonine-protein kinase TAO3 OS=Mus musculus GN=Taok3 PE=1 SV=2 49 310 7.0E-30
sp|Q7ZYJ0|TAO1B_XENLA Serine/threonine-protein kinase TAO1-B OS=Xenopus laevis GN=taok1-b PE=2 SV=1 49 330 8.0E-30
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 43 310 8.0E-30
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 43 310 9.0E-30
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 43 310 9.0E-30
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 43 310 9.0E-30
sp|Q53UA7|TAOK3_RAT Serine/threonine-protein kinase TAO3 OS=Rattus norvegicus GN=Taok3 PE=1 SV=1 49 310 1.0E-29
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 43 309 1.0E-29
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 43 304 1.0E-29
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 43 318 1.0E-29
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 43 304 2.0E-29
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 49 313 2.0E-29
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 41 327 2.0E-29
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 35 321 2.0E-29
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 43 310 3.0E-29
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 49 326 3.0E-29
sp|Q5R4F3|TAOK3_PONAB Serine/threonine-protein kinase TAO3 OS=Pongo abelii GN=TAOK3 PE=2 SV=1 49 310 3.0E-29
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 43 310 3.0E-29
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 49 317 4.0E-29
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 43 321 5.0E-29
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 49 335 6.0E-29
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 43 310 7.0E-29
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 43 310 7.0E-29
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 25 310 7.0E-29
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 47 315 7.0E-29
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 49 317 8.0E-29
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 43 306 9.0E-29
sp|B0WAU8|PLK4_CULQU Serine/threonine-protein kinase PLK4 OS=Culex quinquefasciatus GN=SAK PE=3 SV=1 43 312 1.0E-28
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 37 313 1.0E-28
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 41 304 1.0E-28
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 43 310 1.0E-28
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 43 310 1.0E-28
sp|Q6GPK9|TAOK2_XENLA Serine/threonine-protein kinase TAO2 OS=Xenopus laevis GN=taok2 PE=2 SV=1 49 310 1.0E-28
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 39 306 1.0E-28
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 43 310 2.0E-28
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 36 331 2.0E-28
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 43 306 3.0E-28
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus GN=Taok2 PE=1 SV=3 38 312 3.0E-28
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 49 311 3.0E-28
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 35 321 3.0E-28
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 43 316 3.0E-28
sp|Q9JLS3|TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus GN=Taok2 PE=1 SV=1 38 312 3.0E-28
sp|P08018|PBS2_YEAST MAP kinase kinase PBS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBS2 PE=1 SV=4 49 336 4.0E-28
sp|Q9UL54|TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens GN=TAOK2 PE=1 SV=2 38 312 4.0E-28
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 49 317 4.0E-28
sp|Q54DC8|Y2350_DICDI Probable serine/threonine-protein kinase DDB_G0292350 OS=Dictyostelium discoideum GN=DDB_G0292350 PE=3 SV=1 49 310 5.0E-28
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 34 312 5.0E-28
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 45 312 5.0E-28
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 43 310 5.0E-28
sp|Q6AXJ9|CDKL1_DANRE Cyclin-dependent kinase-like 1 OS=Danio rerio GN=cdkl1 PE=2 SV=1 49 310 5.0E-28
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 36 331 6.0E-28
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 43 310 6.0E-28
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 43 304 9.0E-28
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 43 306 9.0E-28
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 36 331 9.0E-28
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 49 312 1.0E-27
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 43 319 1.0E-27
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 43 298 1.0E-27
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 36 331 1.0E-27
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 43 319 2.0E-27
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 43 304 2.0E-27
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 43 306 2.0E-27
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 43 304 2.0E-27
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 49 322 2.0E-27
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 43 310 2.0E-27
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 43 341 2.0E-27
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 38 310 3.0E-27
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 37 312 4.0E-27
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 43 304 4.0E-27
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 43 320 4.0E-27
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 43 362 4.0E-27
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 43 342 6.0E-27
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 42 314 6.0E-27
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 37 312 8.0E-27
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 43 312 8.0E-27
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 40 329 9.0E-27
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 42 307 1.0E-26
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 37 313 1.0E-26
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 37 313 1.0E-26
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 48 310 1.0E-26
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 47 310 1.0E-26
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 43 321 1.0E-26
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 43 312 2.0E-26
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 48 310 2.0E-26
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 43 312 2.0E-26
sp|Q00532|CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens GN=CDKL1 PE=1 SV=5 49 310 2.0E-26
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 47 316 3.0E-26
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 43 304 3.0E-26
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 48 310 3.0E-26
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 48 310 3.0E-26
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 43 312 4.0E-26
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 45 304 4.0E-26
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 43 357 4.0E-26
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 43 312 4.0E-26
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 49 310 6.0E-26
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 45 315 6.0E-26
sp|Q66HE7|CDKL1_RAT Cyclin-dependent kinase-like 1 OS=Rattus norvegicus GN=Cdkl1 PE=2 SV=1 49 316 7.0E-26
sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 45 253 7.0E-26
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 40 310 8.0E-26
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 43 330 1.0E-25
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 37 312 1.0E-25
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 29 310 1.0E-25
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 37 310 2.0E-25
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 48 310 2.0E-25
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 43 310 2.0E-25
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 34 251 2.0E-25
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 43 310 2.0E-25
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 49 315 2.0E-25
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 49 321 2.0E-25
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 43 312 3.0E-25
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 37 310 3.0E-25
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 43 304 3.0E-25
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 43 310 3.0E-25
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 49 250 3.0E-25
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 43 312 3.0E-25
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 37 310 3.0E-25
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 43 319 3.0E-25
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 34 310 3.0E-25
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 43 307 4.0E-25
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 43 312 4.0E-25
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 43 304 4.0E-25
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 34 310 4.0E-25
sp|Q9QUK0|CDKL2_MOUSE Cyclin-dependent kinase-like 2 OS=Mus musculus GN=Cdkl2 PE=2 SV=1 48 310 5.0E-25
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 35 304 5.0E-25
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 43 298 5.0E-25
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 34 310 5.0E-25
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 43 310 6.0E-25
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 43 315 6.0E-25
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 43 314 6.0E-25
sp|Q5XIT0|CDKL2_RAT Cyclin-dependent kinase-like 2 OS=Rattus norvegicus GN=Cdkl2 PE=2 SV=1 48 310 7.0E-25
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 37 316 7.0E-25
sp|A7A1P0|STE11_YEAS7 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain YJM789) GN=STE11 PE=3 SV=1 49 310 8.0E-25
sp|P23561|STE11_YEAST Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE11 PE=1 SV=3 49 310 8.0E-25
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 47 314 8.0E-25
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 43 318 8.0E-25
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 43 309 8.0E-25
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 43 318 9.0E-25
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 43 306 9.0E-25
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 37 316 1.0E-24
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 43 310 1.0E-24
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 37 312 1.0E-24
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 43 320 1.0E-24
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 37 316 1.0E-24
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 37 316 1.0E-24
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 43 314 1.0E-24
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 43 312 1.0E-24
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 49 315 1.0E-24
sp|Q4G3H4|IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio GN=chuk PE=1 SV=1 39 251 1.0E-24
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 43 298 1.0E-24
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 37 310 1.0E-24
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 43 318 1.0E-24
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 37 408 1.0E-24
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 43 307 2.0E-24
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 43 307 2.0E-24
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 43 307 2.0E-24
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 43 310 2.0E-24
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 43 318 2.0E-24
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 43 300 2.0E-24
sp|Q54MY9|MKCA_DICDI Probable serine/threonine-protein kinase mkcA OS=Dictyostelium discoideum GN=mkcA PE=2 SV=1 33 310 2.0E-24
sp|Q869X3|Y9851_DICDI Probable serine/threonine-protein kinase DDB_G0275165 OS=Dictyostelium discoideum GN=DDB_G0275165 PE=3 SV=1 48 304 2.0E-24
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 37 316 2.0E-24
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 43 314 2.0E-24
sp|Q59S66|IPL1_CANAL Spindle assembly checkpoint kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPL1 PE=3 SV=1 43 318 2.0E-24
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 43 310 2.0E-24
sp|B5VNQ3|STE11_YEAS6 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=STE11 PE=3 SV=2 49 307 2.0E-24
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 43 312 2.0E-24
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans GN=let-502 PE=1 SV=1 29 319 2.0E-24
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 43 307 3.0E-24
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 10 307 3.0E-24
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 43 307 3.0E-24
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 48 298 3.0E-24
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 43 312 3.0E-24
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 43 310 3.0E-24
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 43 306 3.0E-24
sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 OS=Homo sapiens GN=CDKL4 PE=2 SV=2 50 250 3.0E-24
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 43 312 3.0E-24
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 43 317 3.0E-24
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 43 322 3.0E-24
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 43 307 3.0E-24
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 42 306 4.0E-24
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 43 312 4.0E-24
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 17 251 4.0E-24
sp|P10676|NINAC_DROME Neither inactivation nor afterpotential protein C OS=Drosophila melanogaster GN=ninaC PE=1 SV=2 43 310 4.0E-24
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 40 251 5.0E-24
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 43 310 5.0E-24
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 47 314 5.0E-24
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 43 310 5.0E-24
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 43 310 5.0E-24
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 43 251 6.0E-24
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 32 312 6.0E-24
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 42 327 7.0E-24
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 47 310 7.0E-24
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 46 303 7.0E-24
sp|O14733|MP2K7_HUMAN Dual specificity mitogen-activated protein kinase kinase 7 OS=Homo sapiens GN=MAP2K7 PE=1 SV=2 49 314 7.0E-24
sp|O14098|CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsk1 PE=1 SV=1 41 263 7.0E-24
sp|A8WVU9|ROCK_CAEBR Rho-associated protein kinase let-502 OS=Caenorhabditis briggsae GN=let-502 PE=3 SV=2 29 319 8.0E-24
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 46 303 8.0E-24
sp|Q54VC0|Y9865_DICDI Probable serine/threonine-protein kinase DDB_G0280461 OS=Dictyostelium discoideum GN=DDB_G0280461 PE=3 SV=1 51 306 8.0E-24
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 43 318 8.0E-24
sp|Q9LPQ3|M2K7_ARATH Mitogen-activated protein kinase kinase 7 OS=Arabidopsis thaliana GN=MKK7 PE=1 SV=1 47 310 9.0E-24
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 43 312 9.0E-24
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 35 307 9.0E-24
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 43 322 1.0E-23
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 43 316 1.0E-23
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 43 310 1.0E-23
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 43 307 1.0E-23
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 43 312 1.0E-23
sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase DDB_G0282895 OS=Dictyostelium discoideum GN=DDB_G0282895 PE=3 SV=1 34 306 1.0E-23
sp|Q4KSH7|MP2K7_RAT Dual specificity mitogen-activated protein kinase kinase 7 OS=Rattus norvegicus GN=Map2k7 PE=1 SV=1 49 310 1.0E-23
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 46 303 1.0E-23
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 43 314 1.0E-23
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 26 307 1.0E-23
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 34 298 2.0E-23
sp|Q23915|KINX_DICDI Probable serine/threonine-protein kinase kinX OS=Dictyostelium discoideum GN=kinX PE=3 SV=2 49 313 2.0E-23
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 35 318 2.0E-23
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 10 307 2.0E-23
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 43 327 2.0E-23
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 34 310 2.0E-23
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 34 310 2.0E-23
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 40 251 2.0E-23
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 19 315 2.0E-23
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 19 315 2.0E-23
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 19 315 2.0E-23
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 22 251 2.0E-23
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 43 310 2.0E-23
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 48 304 2.0E-23
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 43 306 2.0E-23
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 43 310 2.0E-23
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 9 321 2.0E-23
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 9 311 2.0E-23
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 43 310 2.0E-23
sp|Q5HZ38|GRIK2_ARATH Serine/threonine-protein kinase GRIK2 OS=Arabidopsis thaliana GN=GRIK2 PE=1 SV=1 49 318 2.0E-23
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 37 310 2.0E-23
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 48 307 3.0E-23
sp|Q55DD4|PAKD_DICDI Serine/threonine-protein kinase pakD OS=Dictyostelium discoideum GN=pakD PE=3 SV=1 43 312 3.0E-23
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 42 315 3.0E-23
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 48 310 3.0E-23
sp|Q8CE90|MP2K7_MOUSE Dual specificity mitogen-activated protein kinase kinase 7 OS=Mus musculus GN=Map2k7 PE=1 SV=1 49 310 3.0E-23
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 9 315 3.0E-23
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 28 328 3.0E-23
sp|Q54TN4|MKCE_DICDI Probable serine/threonine-protein kinase mkcE OS=Dictyostelium discoideum GN=mkcE PE=3 SV=1 51 310 3.0E-23
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 42 329 4.0E-23
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 43 310 4.0E-23
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 43 312 4.0E-23
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 43 298 4.0E-23
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 33 328 4.0E-23
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 48 310 4.0E-23
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 43 310 5.0E-23
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 43 310 5.0E-23
sp|P46549|SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans GN=kin-18 PE=2 SV=1 49 330 6.0E-23
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 43 312 6.0E-23
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 43 315 6.0E-23
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 33 328 6.0E-23
sp|Q55CE0|MKCF_DICDI Probable serine/threonine-protein kinase mkcF OS=Dictyostelium discoideum GN=mkcF PE=3 SV=1 45 314 6.0E-23
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 49 298 6.0E-23
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 43 310 6.0E-23
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 47 306 7.0E-23
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 49 315 7.0E-23
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 43 315 8.0E-23
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 43 310 8.0E-23
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 34 307 8.0E-23
sp|P53669|LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus GN=Limk1 PE=1 SV=1 47 334 8.0E-23
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 34 312 8.0E-23
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 47 310 8.0E-23
sp|Q9BZL6|KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens GN=PRKD2 PE=1 SV=2 47 310 8.0E-23
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 48 312 8.0E-23
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 49 315 8.0E-23
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 43 251 9.0E-23
sp|P53668|LIMK1_MOUSE LIM domain kinase 1 OS=Mus musculus GN=Limk1 PE=1 SV=1 47 306 9.0E-23
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 43 260 1.0E-22
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 49 298 1.0E-22
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 45 369 1.0E-22
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 43 315 1.0E-22
sp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2 47 316 1.0E-22
sp|Q7ZVS3|PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio GN=plk4 PE=2 SV=2 43 310 1.0E-22
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 43 306 1.0E-22
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 38 313 1.0E-22
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 43 327 1.0E-22
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 19 315 1.0E-22
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 43 260 1.0E-22
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 34 298 1.0E-22
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 49 315 1.0E-22
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 34 298 2.0E-22
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 43 251 2.0E-22
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 39 310 2.0E-22
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 43 318 2.0E-22
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 43 310 2.0E-22
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 39 298 2.0E-22
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 47 251 2.0E-22
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 40 251 2.0E-22
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 40 251 2.0E-22
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 49 315 2.0E-22
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 43 311 2.0E-22
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 40 251 2.0E-22
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 43 310 2.0E-22
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 40 251 2.0E-22
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 5 298 2.0E-22
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 34 330 2.0E-22
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 49 315 2.0E-22
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 49 315 2.0E-22
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 43 310 2.0E-22
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 39 251 2.0E-22
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 39 251 2.0E-22
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 40 251 2.0E-22
sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 44 304 2.0E-22
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 43 315 2.0E-22
sp|Q62862|MP2K5_RAT Dual specificity mitogen-activated protein kinase kinase 5 OS=Rattus norvegicus GN=Map2k5 PE=1 SV=1 49 337 2.0E-22
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 49 315 2.0E-22
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 49 310 2.0E-22
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 43 310 2.0E-22
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 34 330 2.0E-22
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 49 310 3.0E-22
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 42 318 3.0E-22
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 35 307 3.0E-22
sp|Q5XIS9|KPCD2_RAT Serine/threonine-protein kinase D2 OS=Rattus norvegicus GN=Prkd2 PE=1 SV=1 47 310 3.0E-22
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 49 315 3.0E-22
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 49 310 3.0E-22
sp|O94768|ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens GN=STK17B PE=1 SV=1 46 310 3.0E-22
sp|Q8BZ03|KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus GN=Prkd2 PE=1 SV=1 47 310 3.0E-22
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 43 310 3.0E-22
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 43 310 3.0E-22
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 43 310 3.0E-22
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 43 310 3.0E-22
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 48 298 3.0E-22
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 43 311 3.0E-22
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 43 310 3.0E-22
sp|Q9WVS7|MP2K5_MOUSE Dual specificity mitogen-activated protein kinase kinase 5 OS=Mus musculus GN=Map2k5 PE=1 SV=1 49 337 3.0E-22
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 49 315 3.0E-22
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 43 251 5.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7844
MAALHLKWPELSSIKQRALEDAKKMQKAVVEECARTGKEPPPYHLSELIGKGSFGRVYKASAQKTGQLVAVKIID
IEESDTLNPKLADTYSDLLKEISALQLLSESGAKNVNHVMEALPVGQSMWMITEYCAGGSVATLMKPTAPGGLQE
KWIIPILREVAEAMFWVHGQGIIHRDLKCANVLVTEVGHVQLCDFGVAGVIESKFDKRTTVIGTPHWMAPELFDQ
SASYGTEVDIWAFGAMVYEMASGLPPNVADGIVDFSQLGSHLKQQTPRLEGDKYSAGLKDLVAYCLQQDPKKRPS
IEQIQQHGYIFKTEDAYPTSSLAHLVRGFKLWEAQGGDRRSLFFAGGAQAPSDASSATLVNDEWNFSTTAAFDQH
VFNSGQAQDVYDAYGSNVDFSQQVFEQTSRPTKPKSRRRPPPQLPSVKAPLEKVFDPNTISNYDDNSRAYYGRLF
QAPASDLPLRDESASAADVRESLIDLDASLHGSHLSQFVDMNTIRAGDSRVSAAYDFGETSLYVKAPLSDPADVN
VNRRTQDWKFPTMAPPASANPEMFRFPFTDEASTPEAGRPSLANHPSDPLQASTSFSDLSSSKHSPDNRASMGSL
IDLDMSFPDSSTDYTRPSTSHSDVGSISGSEVGGANPFELEKHASLYVVPTTNREPSIYVSDDSQYAHAVAEPPE
PPPDGDQAQGQPKAATADPSTNGIRPYSLSEFADMDPESMSPPQTVAPVASQFPPSLREPPSEEEEPQEAPPPEQ
LREPSPVIYASLPPLPVAPSSRAMEGRASTDEVKSELRRMAMSLGEHLSHANRYMSSLPVRRGSMTRMEPVADGN
*
Coding >Hirsu2|7844
ATGGCGGCCCTTCACCTCAAGTGGCCGGAGCTCTCCAGCATCAAGCAGCGGGCGCTCGAGGATGCCAAGAAGATG
CAAAAGGCCGTTGTCGAGGAGTGCGCCAGGACCGGAAAGGAACCCCCCCCCTACCACCTCTCCGAGCTCATCGGC
AAGGGGAGCTTCGGCCGCGTCTACAAGGCCTCGGCTCAGAAGACGGGCCAGCTGGTGGCCGTCAAGATCATCGAC
ATCGAGGAGAGCGACACGCTGAACCCGAAGCTGGCCGACACCTACAGCGACCTGCTCAAGGAGATCAGCGCGCTG
CAGCTGCTGAGCGAGAGCGGCGCCAAGAACGTCAACCACGTCATGGAGGCCCTGCCCGTCGGCCAGTCCATGTGG
ATGATCACCGAGTACTGCGCCGGCGGCAGCGTCGCCACCCTCATGAAGCCCACCGCCCCGGGCGGCCTGCAGGAG
AAGTGGATCATCCCCATCCTGCGCGAAGTTGCCGAGGCCATGTTCTGGGTCCATGGCCAGGGCATCATCCATCGC
GACCTCAAGTGCGCCAACGTCCTCGTCACCGAGGTCGGCCATGTCCAGCTGTGCGACTTCGGCGTCGCCGGCGTC
ATCGAGTCCAAGTTCGACAAGCGCACCACCGTCATCGGCACCCCGCACTGGATGGCCCCCGAGCTCTTCGACCAG
TCCGCCTCCTACGGCACCGAGGTCGACATCTGGGCCTTTGGCGCCATGGTCTACGAGATGGCCTCAGGCCTGCCC
CCCAACGTCGCCGATGGTATCGTCGACTTCTCCCAGCTCGGCAGCCACCTGAAGCAGCAGACCCCGCGCCTCGAG
GGAGACAAGTACTCGGCCGGCCTCAAGGACCTCGTCGCTTACTGCCTGCAGCAGGATCCCAAGAAGCGGCCCTCC
ATCGAGCAGATCCAGCAGCACGGCTACATCTTCAAGACCGAAGACGCCTACCCGACCTCCTCCCTCGCCCACCTC
GTCCGGGGCTTCAAGCTGTGGGAAGCCCAGGGCGGCGACCGCCGCTCCCTCTTCTTCGCCGGCGGCGCCCAGGCA
CCCTCGGACGCCTCCTCCGCGACGCTCGTCAACGACGAGTGGAACTTCAGCACCACCGCCGCCTTCGACCAACAC
GTCTTCAACAGCGGCCAGGCCCAGGACGTCTACGACGCCTACGGCTCCAACGTCGACTTCAGCCAGCAAGTCTTC
GAGCAGACCTCGCGCCCTACCAAGCCCAAGTCTCGTCGGCGCCCGCCGCCCCAGCTGCCCTCCGTCAAGGCGCCG
CTGGAAAAGGTGTTCGACCCCAACACGATATCCAACTATGATGACAACTCGAGGGCCTACTACGGTAGGCTCTTC
CAGGCGCCCGCCTCGGATCTGCCGCTGCGGGATGAGTCGGCCTCGGCCGCCGATGTGCGCGAATCTCTGATCGAC
CTGGACGCCTCCTTGCACGGCAGCCACCTGTCTCAGTTTGTCGACATGAACACCATCAGGGCCGGAGACTCGCGC
GTCTCCGCCGCCTACGACTTTGGAGAGACGTCGCTCTACGTCAAGGCACCCCTCAGCGATCCGGCCGACGTCAAC
GTCAACCGTCGCACGCAGGACTGGAAGTTCCCGACCATGGCGCCGCCGGCCTCGGCCAACCCGGAGATGTTCAGG
TTCCCCTTCACCGATGAAGCCTCCACCCCGGAAGCCGGCCGGCCGTCTCTCGCCAATCACCCCAGCGATCCCCTC
CAGGCCTCGACCTCCTTCAGCGACCTCTCTTCCTCGAAGCACAGCCCCGACAACCGCGCTTCGATGGGGAGTCTC
ATCGACCTCGACATGAGCTTCCCGGACTCGTCGACCGACTACACCCGACCGTCGACGTCGCACTCGGATGTCGGC
TCCATCAGCGGCTCCGAGGTCGGCGGCGCGAATCCTTTCGAGCTCGAGAAGCACGCGTCCCTGTACGTGGTGCCC
ACCACGAACCGCGAGCCGTCCATCTACGTTTCGGACGACTCGCAGTACGCCCACGCCGTCGCTGAGCCGCCCGAG
CCGCCGCCCGATGGCGACCAGGCCCAGGGACAACCAAAGGCGGCCACCGCCGATCCGTCCACCAACGGCATCCGC
CCCTATTCTCTCAGCGAATTCGCCGACATGGACCCCGAGTCCATGTCCCCCCCGCAGACGGTCGCGCCCGTCGCA
TCCCAATTCCCGCCGTCGCTCCGGGAGCCGCCATCGGAGGAGGAGGAGCCCCAAGAGGCTCCCCCCCCCGAGCAG
CTCCGGGAGCCGTCGCCCGTCATCTACGCCTCCCTGCCCCCACTGCCCGTCGCGCCCTCGTCCCGGGCAATGGAG
GGCCGAGCGTCCACGGACGAGGTGAAGAGCGAGCTGCGGCGCATGGCCATGAGCCTGGGGGAACACCTGAGCCAC
GCCAACCGGTACATGTCGAGCCTGCCCGTCCGCAGGGGGAGCATGACGAGGATGGAGCCCGTTGCAGACGGAAAC
TGA
Transcript >Hirsu2|7844
ATGGCGGCCCTTCACCTCAAGTGGCCGGAGCTCTCCAGCATCAAGCAGCGGGCGCTCGAGGATGCCAAGAAGATG
CAAAAGGCCGTTGTCGAGGAGTGCGCCAGGACCGGAAAGGAACCCCCCCCCTACCACCTCTCCGAGCTCATCGGC
AAGGGGAGCTTCGGCCGCGTCTACAAGGCCTCGGCTCAGAAGACGGGCCAGCTGGTGGCCGTCAAGATCATCGAC
ATCGAGGAGAGCGACACGCTGAACCCGAAGCTGGCCGACACCTACAGCGACCTGCTCAAGGAGATCAGCGCGCTG
CAGCTGCTGAGCGAGAGCGGCGCCAAGAACGTCAACCACGTCATGGAGGCCCTGCCCGTCGGCCAGTCCATGTGG
ATGATCACCGAGTACTGCGCCGGCGGCAGCGTCGCCACCCTCATGAAGCCCACCGCCCCGGGCGGCCTGCAGGAG
AAGTGGATCATCCCCATCCTGCGCGAAGTTGCCGAGGCCATGTTCTGGGTCCATGGCCAGGGCATCATCCATCGC
GACCTCAAGTGCGCCAACGTCCTCGTCACCGAGGTCGGCCATGTCCAGCTGTGCGACTTCGGCGTCGCCGGCGTC
ATCGAGTCCAAGTTCGACAAGCGCACCACCGTCATCGGCACCCCGCACTGGATGGCCCCCGAGCTCTTCGACCAG
TCCGCCTCCTACGGCACCGAGGTCGACATCTGGGCCTTTGGCGCCATGGTCTACGAGATGGCCTCAGGCCTGCCC
CCCAACGTCGCCGATGGTATCGTCGACTTCTCCCAGCTCGGCAGCCACCTGAAGCAGCAGACCCCGCGCCTCGAG
GGAGACAAGTACTCGGCCGGCCTCAAGGACCTCGTCGCTTACTGCCTGCAGCAGGATCCCAAGAAGCGGCCCTCC
ATCGAGCAGATCCAGCAGCACGGCTACATCTTCAAGACCGAAGACGCCTACCCGACCTCCTCCCTCGCCCACCTC
GTCCGGGGCTTCAAGCTGTGGGAAGCCCAGGGCGGCGACCGCCGCTCCCTCTTCTTCGCCGGCGGCGCCCAGGCA
CCCTCGGACGCCTCCTCCGCGACGCTCGTCAACGACGAGTGGAACTTCAGCACCACCGCCGCCTTCGACCAACAC
GTCTTCAACAGCGGCCAGGCCCAGGACGTCTACGACGCCTACGGCTCCAACGTCGACTTCAGCCAGCAAGTCTTC
GAGCAGACCTCGCGCCCTACCAAGCCCAAGTCTCGTCGGCGCCCGCCGCCCCAGCTGCCCTCCGTCAAGGCGCCG
CTGGAAAAGGTGTTCGACCCCAACACGATATCCAACTATGATGACAACTCGAGGGCCTACTACGGTAGGCTCTTC
CAGGCGCCCGCCTCGGATCTGCCGCTGCGGGATGAGTCGGCCTCGGCCGCCGATGTGCGCGAATCTCTGATCGAC
CTGGACGCCTCCTTGCACGGCAGCCACCTGTCTCAGTTTGTCGACATGAACACCATCAGGGCCGGAGACTCGCGC
GTCTCCGCCGCCTACGACTTTGGAGAGACGTCGCTCTACGTCAAGGCACCCCTCAGCGATCCGGCCGACGTCAAC
GTCAACCGTCGCACGCAGGACTGGAAGTTCCCGACCATGGCGCCGCCGGCCTCGGCCAACCCGGAGATGTTCAGG
TTCCCCTTCACCGATGAAGCCTCCACCCCGGAAGCCGGCCGGCCGTCTCTCGCCAATCACCCCAGCGATCCCCTC
CAGGCCTCGACCTCCTTCAGCGACCTCTCTTCCTCGAAGCACAGCCCCGACAACCGCGCTTCGATGGGGAGTCTC
ATCGACCTCGACATGAGCTTCCCGGACTCGTCGACCGACTACACCCGACCGTCGACGTCGCACTCGGATGTCGGC
TCCATCAGCGGCTCCGAGGTCGGCGGCGCGAATCCTTTCGAGCTCGAGAAGCACGCGTCCCTGTACGTGGTGCCC
ACCACGAACCGCGAGCCGTCCATCTACGTTTCGGACGACTCGCAGTACGCCCACGCCGTCGCTGAGCCGCCCGAG
CCGCCGCCCGATGGCGACCAGGCCCAGGGACAACCAAAGGCGGCCACCGCCGATCCGTCCACCAACGGCATCCGC
CCCTATTCTCTCAGCGAATTCGCCGACATGGACCCCGAGTCCATGTCCCCCCCGCAGACGGTCGCGCCCGTCGCA
TCCCAATTCCCGCCGTCGCTCCGGGAGCCGCCATCGGAGGAGGAGGAGCCCCAAGAGGCTCCCCCCCCCGAGCAG
CTCCGGGAGCCGTCGCCCGTCATCTACGCCTCCCTGCCCCCACTGCCCGTCGCGCCCTCGTCCCGGGCAATGGAG
GGCCGAGCGTCCACGGACGAGGTGAAGAGCGAGCTGCGGCGCATGGCCATGAGCCTGGGGGAACACCTGAGCCAC
GCCAACCGGTACATGTCGAGCCTGCCCGTCCGCAGGGGGAGCATGACGAGGATGGAGCCCGTTGCAGACGGAAAC
TGA
Gene >Hirsu2|7844
ATGGCGGCCCTTCACCTCAAGTGGCCGGAGCTCTCCAGCATCAAGCAGCGGGCGCTCGAGGATGCCAAGAAGATG
CAAAAGGCCGTTGTCGAGGAGTGCGCCAGGACCGGAAAGGAACCCCCCCCCTACCACCTCTCCGAGCTCATCGGC
AAGGGGAGCTTCGGCCGCGTCTACAAGGCCTCGGCTCAGAAGACGGGCCAGCTGGTGGCCGTCAAGATCATCGAC
ATCGAGGAGAGCGACACGCTGAACCCGAAGCTGGCCGACACCTACAGCGACCTGCTCAAGGAGATCAGCGCGCTG
CAGCTGCTGAGCGAGAGCGGCGCCAAGAACGTCAACCACGTCATGGAGGCCCTGCCCGTCGGCCAGTCCATGTGG
ATGATCACCGAGTACTGCGCCGGCGGCAGCGTCGCCACCCTCATGAAGCCCACCGCCCCGGGCGGCCTGCAGGAG
AAGTGGATCATCCCCATCCTGCGCGAAGTTGCCGAGGCCATGTTCTGGGTCCATGGCCAGGGCATCATCCATCGC
GACCTCAAGTGCGCCAACGTCCTCGTCACCGAGGTCGGCCATGTCCAGCTGTGCGACTTCGGCGTCGCCGGCGTC
ATCGAGTCCAAGTTCGACAAGCGCACCACCGTCATCGGCACCCCGCACTGGATGGCCCCCGAGCTCTTCGACCAG
TCCGCCTCCTACGGCACCGAGGTCGACATCTGGGCCTTTGGCGCCATGGTCTACGAGATGGCCTCAGGCCTGCCC
CCCAACGTCGCCGATGGTATCGTCGACTTCTCCCAGCTCGGCAGCCACCTGAAGCAGCAGACCCCGCGCCTCGAG
GGAGACAAGTACTCGGCCGGCCTCAAGGACCTCGTCGCTTACTGCCTGCAGCAGGATCCCAAGAAGCGGCCCTCC
ATCGAGCAGATCCAGCAGCACGGCTACATCTTCAAGACCGAAGACGCCTACCCGACCTCCTCCCTCGCCCACCTC
GTCCGGGGCTTCAAGCTGTGGGAAGCCCAGGGCGGCGACCGCCGCTCCCTCTTCTTCGCCGGCGGCGCCCAGGCA
CCCTCGGACGCCTCCTCCGCGACGCTCGTCAACGACGAGTGGAACTTCAGCACCACCGCCGCCTTCGACCAACAC
GTCTTCAACAGCGGCCAGGCCCAGGACGTCTACGACGCCTACGGCTCCAACGTCGACTTCAGCCAGCAAGTCTTC
GAGCAGACCTCGCGCCCTACCAAGCCCAAGTCTCGTCGGCGCCCGCCGCCCCAGCTGCCCTCCGTCAAGGCGCCG
CTGGAAAAGGTGTTCGACCCCAACACGATATCCAACTATGATGACAACTCGAGGGCCTACTACGGTAGGCTCTTC
CAGGCGCCCGCCTCGGATCTGCCGCTGCGGGATGAGTCGGCCTCGGCCGCCGATGTGCGCGAATCTCTGATCGAC
CTGGACGCCTCCTTGCACGGCAGCCACCTGTCTCAGTTTGTCGACATGAACACCATCAGGGCCGGAGACTCGCGC
GTCTCCGCCGCCTACGACTTTGGAGAGACGTCGCTCTACGTCAAGGCACCCCTCAGCGATCCGGCCGACGTCAAC
GTCAACCGTCGCACGCAGGACTGGAAGTTCCCGACCATGGCGCCGCCGGCCTCGGCCAACCCGGAGATGTTCAGG
TTCCCCTTCACCGATGAAGCCTCCACCCCGGAAGCCGGCCGGCCGTCTCTCGCCAATCACCCCAGCGATCCCCTC
CAGGCCTCGACCTCCTTCAGCGACCTCTCTTCCTCGAAGCACAGCCCCGACAACCGCGCTTCGATGGGGAGTCTC
ATCGACCTCGACATGAGCTTCCCGGACTCGTCGACCGACTACACCCGACCGTCGACGTCGCACTCGGATGTCGGC
TCCATCAGCGGCTCCGAGGTCGGCGGCGCGAATCCTTTCGAGCTCGAGAAGCACGCGTCCCTGTACGTGGTGCCC
ACCACGAACCGCGAGCCGTCCATCTACGTTTCGGACGACTCGCAGTACGCCCACGCCGTCGCTGAGCCGCCCGAG
CCGCCGCCCGATGGCGACCAGGCCCAGGGACAACCAAAGGCGGCCACCGCCGATCCGTCCACCAACGGCATCCGC
CCCTATTCTCTCAGCGAATTCGCCGACATGGACCCCGAGTCCATGTCCCCCCCGCAGACGGTCGCGCCCGTCGCA
TCCCAATTCCCGCCGTCGCTCCGGGAGCCGCCATCGGAGGAGGAGGAGCCCCAAGAGGCTCCCCCCCCCGAGCAG
CTCCGGGAGCCGTCGCCCGTCATCTACGCCTCCCTGCCCCCACTGCCCGTCGCGCCCTCGTCCCGGGCAATGGAG
GGCCGAGCGTCCACGGACGAGGTGAAGAGCGAGCTGCGGCGCATGGCCATGAGCCTGGGGGAACACCTGAGCCAC
GCCAACCGGTACATGTCGAGCCTGCCCGTCCGCAGGGGGAGCATGACGAGGATGGAGCCCGTTGCAGACGGAAAC
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail